KEGG   Pediococcus claussenii: PECL_1083Help
Entry
PECL_1083         CDS       T01713                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pce  Pediococcus claussenii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pce00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1081680..1082771)
Genome map
AA seq 363 aa AA seqDB search
MKFTEINLESKIAQNIFKSNQLVLIKVEDIGHDEENKLRVLISKFDSVFEEKQFALPIAA
LQIFSKKLFETFTTDAGFQNIIKEHQVVWKYGRFTRETQFNPLVYGVLNTSPDSFYDGGR
YTDMQSVISRVEKMIEAGVDIIEVGGQTTKPGFKEISPETEIERTVPYLKEIKGRFPGVA
LAIDTYKFPVMKAAIDYVDIINDVNGFTDDSRKLDLLAASSVGLLSMHSNRSNDYDNLTD
EVHAFFEGNLKEISEAGIDQERIALDQGIGYATVADGYQDYAMMRNINQLLDFKRPIIIA
ISRKGFGKKLFGLEREDRLAVTLVAESSMFLSGGRILRVHDIEETVQLIKMLKTIQIGYW
FKP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaccgagattaatttggagtccaaaatagctcaaaatatttttaagtctaat
caattggttttaattaaggttgaagatattggacatgatgaggaaaataagctgcgtgta
ctaattagcaaatttgatagtgtttttgaagaaaaacagtttgccttgccaattgccgcg
ttacaaattttttcaaaaaaactttttgagacattcacaacagatgccggttttcaaaat
atcattaaagagcatcaagtggtttggaaatatgggcgatttaccagagaaacccagttt
aatccattggtctatggggtgttaaatacaagccctgattctttttatgatggtggaaga
tatactgatatgcagtctgtgatatcacgtgttgaaaaaatgattgaagctggagttgat
attattgaagttggtgggcaaacgaccaaacccggctttaaggaaatctcacctgagacg
gaaattgagagaactgttccatatttaaaagaaattaaagggcgtttcccgggtgtagca
ctagcaattgacacgtataagtttcctgtgatgaaagctgcaattgattacgtcgatatt
attaatgatgtgaacggatttacagatgacagtcgaaaattagatttactagcagcttct
tcggtaggattattatcaatgcacagtaatcgaagtaacgactacgacaatctgactgat
gaagttcatgctttttttgaggggaatctgaaggaaataagtgaagcaggaattgatcaa
gagcgaatagcacttgatcaaggaatcggttatgcaacagttgcagacggatatcaagat
tatgctatgatgcgtaatataaaccagttattggattttaagcggccaataattattgca
atttcgcgaaaaggctttggaaaaaagttatttggcttagagcgtgaggatagattagcg
gttaccttggttgcagaaagttctatgtttttaagcggaggacgcattttacgagtgcac
gatattgaagagactgttcaactcattaaaatgttaaaaacaattcagattggttattgg
tttaagccataa

DBGET integrated database retrieval system