KEGG   Pediococcus claussenii: PECL_1086Help
Entry
PECL_1086         CDS       T01713                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
Organism
pce  Pediococcus claussenii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1084665..1085210)
Genome map
AA seq 181 aa AA seqDB search
MNNSEIEKATASILKAIGDDPERSSVKETPKRVAKAFNEIFAHTNDQQFNDFKLFDIDDD
DQTVVVRNIPFYSMCEHHLLPFFGTVDVAYVPNNGKIIGLSKIPRLVDFVAKRPNVQENM
TSMLITEMNRILNPKGVAVKITARHMCMEMRGINKQGEETTTTKFQGIFKSDSIMRSEFL
N
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagtgaaatcgagaaagcaactgctagcatattaaaagcaatcggtgatgat
ccagaacgttcatccgtaaaagagacgccgaaacgggttgctaaggcttttaatgaaata
tttgcgcatactaatgatcaacaatttaatgattttaagctttttgatattgatgatgat
gatcaaactgtagtagttcggaatataccattttattcaatgtgcgagcatcatttactc
cccttttttggaactgtggatgtagcctatgtgccaaacaatggaaaaattattggactt
tccaaaattccaagactggtagattttgtcgcaaaaagaccgaacgtacaggagaatatg
accagtatgctaataacagagatgaatagaattttgaatcccaagggggttgcggttaag
attaccgcgcgacacatgtgcatggaaatgcgtggaataaataaacagggtgaagagaca
accactactaaatttcaaggaatatttaaaagcgattctataatgagaagtgaatttttg
aattaa

DBGET integrated database retrieval system