KEGG   Pediococcus claussenii: PECL_1143Help
Entry
PECL_1143         CDS       T01713                                 

Gene name
gpx2
Definition
(GenBank) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pce  Pediococcus claussenii
Pathway
pce00480  Glutathione metabolism
pce00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PECL_1143 (gpx2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PECL_1143 (gpx2)
Enzymes [BR:pce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PECL_1143 (gpx2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-ProteinID: AEV95405
UniProt: G8PDS0
Position
complement(1136374..1136844)
Genome map
AA seq 156 aa AA seqDB search
MTTFYDFSETEMDGKKINFAEYKGKVVIVVNTASKCGFAPQLETLEEIYNEYHSKGLEIL
GLPSNQFKQELKSDEETLDYCQMHYGVTFPMTKRVVVNGKDEDQLFTYLKETSGNGRIKW
NFTKFLIDRDGHLIKRYAPITTPQKMIADIEDAIKK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattttatgatttttcagaaacagagatggatgggaagaagattaattttgct
gagtataaaggaaaagttgtaatagtcgtaaacactgctagtaagtgtgggtttgcacca
caattagagacgcttgaagaaatttataatgagtatcatagtaaggggcttgaaatacta
gggctaccttcaaatcaatttaaacaggaattgaaatctgatgaagagaccctcgattat
tgtcagatgcattacggagttacttttccaatgactaagagagttgttgtgaatggtaaa
gatgaggatcagctgtttacgtatttaaaagaaacatccggtaacggcagaattaagtgg
aattttactaagtttctaattgatagagatggacacttaattaaaaggtacgcaccgata
acaacaccccaaaaaatgattgcggatattgaggatgcaattaagaaataa

DBGET integrated database retrieval system