KEGG   Pediococcus claussenii: PECL_1364Help
Entry
PECL_1364         CDS       T01713                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pce  Pediococcus claussenii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pce00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1324155..1325669
Genome map
AA seq 504 aa AA seqDB search
MSEKYILSIFAGSTSVRSTIFNHDGLQVISFKKDITPHIQHNGWYEQDAIEIWDAVSSTI
ANALIVSEIHPDQIASIGITNQRETTVIWNKKTGIPIYSAIAWQSRQTKDIAYQWIRDGY
SDFFQKKTGLRIDAYFSATKVRWILDNVSGAQEAANHGDLLFGTIDTWVLWNLTKGKTHT
TDYTNASRTMLFNLLDLQWDTEILTLLHIPNSMMPNIKSNSEIYGYTDPDVFFGSSVPIA
GMAGDQQAAFIGNSAFKPGVVKNSYGTGAFIMMNIGESPKISNNKLLTTVAYGINHKVYY
ALEGSIFVAGSAINWLKNGLEMIDDPQESSKLALQSSQTNSLYIVPSFTGLGAPYWDPDA
KGAAFGITEQTNRNDFIKATLQSIAYQAKDVINTMENDSNIRITSVRADGGISRNDYLMQ
FQADLLHIPVNIANTLETKSLGVAFLAGLAVGYWENLNEVQKIYSPGAIFNPVMENAESN
NLYEGWRNAVQATRVYKHVPYQNN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaaatatatattatcgatttttgccggtagcacatccgtacgctccacaatc
tttaatcatgatggacttcaagttatctcgttcaaaaaggatattactccccacatccaa
cacaatggttggtatgagcaagatgcaattgaaatttgggacgccgtatcttccacaatt
gcaaacgctctgatcgtttctgaaattcatcccgatcaaatagccagtattggcatcacc
aatcaacgtgagacaactgtaatttggaacaaaaaaacaggtataccaatttatagtgca
attgcttggcagtcaagacaaaccaaagacatagcctatcaatggattagggatgggtat
tcagatttttttcagaaaaaaactggtttaagaatcgacgcctatttttcagcgaccaag
gttcgttggattctggataatgtttcaggtgctcaggaagctgccaatcatggtgatctt
ttatttggaaccattgatacatgggtattatggaatctaactaagggcaaaactcatacc
acagattacaccaatgctagtcgaactatgctatttaatctgctagacctacaatgggac
acagagattttgaccctattgcatattccaaactcaatgatgccaaatatcaaatcaaac
tccgaaatatatggttatactgatccagatgtcttttttggtagttctgttcccattgct
ggcatggcgggtgaccaacaagcagccttcattggcaatagtgctttcaaacctggggtc
gttaaaaactcgtatgggactggtgcctttatcatgatgaacattggtgaatcacctaaa
atatctaataataaattactaacaactgttgcttatggtattaatcataaagtttactac
gcgcttgaaggtagcatcttcgttgctgggtccgcaattaactggcttaaaaatggtttg
gaaatgattgatgatccacaagaatcttctaaactagcattacaatcaagtcaaacaaat
agtctgtacattgttccttcatttactggtcttggagccccatactgggatccagatgct
aagggtgcagccttcggaatcaccgagcaaaccaacagaaatgattttatcaaagccacc
ttacaatcaattgcgtatcaggctaaggatgttattaatactatggaaaatgattctaat
attagaattacatcagttagagctgacggtggtatttcacgcaatgattatctgatgcaa
tttcaagctgacttgctacatatccctgttaatattgcaaatactttggaaacaaaatct
cttggtgttgcctttttagcaggattagcagttggatattgggaaaatctaaacgaagta
caaaagatttacagtccaggcgcaatttttaatcccgtaatggaaaatgccgagagtaac
aatctttatgaaggatggcgaaacgctgttcaagccacacgcgtctacaaacacgttcct
tatcagaataactga

DBGET integrated database retrieval system