KEGG   Pediococcus claussenii: PECL_1408Help
Entry
PECL_1408         CDS       T01713                                 

Gene name
hemD
Definition
(GenBank) putative uroporphyrinogen-III synthase HemD
Organism
pce  Pediococcus claussenii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Cation_ATPase_N
Motif
Other DBs
NCBI-ProteinID: AEV95632
UniProt: G8PEM3
Position
complement(1360704..1361417)
Genome map
AA seq 237 aa AA seqDB search
MMAILITRNISEVNEELRSELKDIPVTYLSLKRIEPITLKVATEKLIRSTDYLVLTSLEA
AKIMINEDLIEDFNKELFVLSNHIARLCEANGFKNIIVAQSENRKSVLESVKIINQQSVH
GVFLKGNLAPMIEQEGLMNIDIYRNTWSKKDQDRANESLKYPGYTQVLITSSSAVKRFAQ
LEKRNVSKFVGADFFSLGDATYRQIKQFGFNAIPPVKCVPVLKETLKQMNNLRKERD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaattttaattacacgtaatataagcgaagttaatgaagagttgcggagtgaa
ttgaaagacataccagtgacctatttaagccttaagcgtatcgaaccgatcactttaaaa
gttgcaacggagaaattaattcgttcaactgattatcttgttttgaccagtttagaagcg
gctaaaatcatgattaatgaagatctgattgaagattttaataaagagttgtttgttctt
agtaaccacattgcaaggctatgtgaagcgaatggattcaaaaatattatagttgcacag
agtgaaaatcgaaaaagcgtgttggaatcggtcaaaataatcaaccagcaatcagtgcat
ggagtttttttaaaagggaatttagctccgatgattgagcaggaaggcttgatgaatatc
gatatttatcggaatacttggagcaaaaaagatcaagatcgagcaaatgaatcgttaaaa
tatcctgggtatacccaagtgctgattacaagttcttctgctgttaaacgctttgctcaa
ttagaaaaacgaaatgtttctaaatttgtaggtgcagattttttttcattgggggatgct
acttatcggcaaattaagcaatttggtttcaatgcgatcccgcctgtaaagtgcgttcca
gttttaaaagaaacattgaaacaaatgaataatttgagaaaagaaagggattaa

DBGET integrated database retrieval system