KEGG   Pediococcus claussenii: PECL_1438Help
Entry
PECL_1438         CDS       T01713                                 

Definition
(GenBank) cellulase family protein
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pce  Pediococcus claussenii
Pathway
pce00010  Glycolysis / Gluconeogenesis
pce00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PECL_1438
   00500 Starch and sucrose metabolism
    PECL_1438
Enzymes [BR:pce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PECL_1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AEV95662
UniProt: G8PEY3
Position
complement(1389859..1391175)
Genome map
AA seq 438 aa AA seqDB search
MQTEGGYNEGGKGKSVYDTYQATENSSDWKVGIDNYHHYQEDFDLMAEMGLNSYRFQISW
SRVNPLGDGDFNEEGIAYYDQFINELLKRNIQPMICLYHFDMPLNLAQKYNGFLDRHVVD
AFARYGREMVKRFGDRVKYWITFNEQNLYSTSEAFKIAGYLKGNKTDSELYQISHHVMLA
HAQVTNYIHENTNCQIGGMLAYSEVYPVSPQPKDILYARQIDEFLNHNLLDVFVHGHYSN
EVMTYVKNHNIDMDFQEQDKEVIGKVKSDFIAFSYYQSATISSAIVPENTLPNYYLEAGF
KPNPFLKVSEWGWSIDPLGFRDVLTKVYDQYGVPMFPIENGIGVRETYNGTEIQDDYRIQ
YHQLHIQAMMDAMFEDGVSVIGYLGWGLIDIPSSSGNMEKRYGMVYVNRGNHDLRDMKRI
PKKSYWWFKNYLNQLKQN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagaaggggggtataacgaaggaggaaaaggaaaatctgtttatgatacatac
caggcgactgaaaatagttctgactggaaagtgggtatagataattatcatcattatcaa
gaagattttgatttaatggcagagatggggttaaacagttaccgatttcaaatatcatgg
agtcgagttaatcctctgggcgatggtgattttaatgaagagggaatcgcttactatgat
caattcattaatgaactgttaaaacgtaatattcaaccgatgatttgtttgtaccatttt
gatatgccactgaatttggcacagaagtacaacggatttttagatcgacacgttgttgat
gcttttgctcgatacggacgtgaaatggttaaacgttttggagatcgggtaaaatattgg
attacatttaacgagcagaatctatattcaacgtccgaggcttttaagattgcgggttat
ttaaaaggaaataaaactgatagtgaactttatcaaatatcgcaccatgtaatgctagcg
catgctcaagttactaattacattcacgagaatacgaactgtcaaattggtgggatgtta
gcctatagcgaggtttacccagtttcaccacaaccgaaagatattctctatgcaagacag
attgatgaattcttaaatcataatttattagatgtttttgtacatggtcattactctaat
gaagtaatgacatatgtaaaaaatcataatattgatatggactttcaagaacaggataag
gaagttattggtaaagtaaaaagtgattttattgcctttagttattatcaaagtgccacg
attagtagtgcaattgttccagagaatacacttcctaattactatttggaagctggattt
aaacctaatccgtttttaaaagtttcagaatggggttggtcgattgatccgcttgggttt
agagacgttttgacaaaagtgtatgaccagtatggggttccgatgttccctattgaaaat
ggaattggggtacgggaaacctataacggaactgagattcaggatgattatcgaattcaa
tatcatcagttacatattcaagcaatgatggatgcaatgtttgaagatggtgtctcagtg
attggatacttaggctgggggttaatagatatcccaagttcatcaggaaatatggagaaa
cgctacgggatggtttacgttaatcgtggtaatcatgatttacgtgatatgaagagaatt
cctaaaaaaagttactggtggtttaaaaactatcttaatcaacttaagcaaaattag

DBGET integrated database retrieval system