KEGG   Pediococcus claussenii: PECL_1438Help
Entry
PECL_1438         CDS       T01713                                 

Definition
cellulase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pce  Pediococcus claussenii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pce00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1389859..1391175)
Genome map
AA seq 438 aa AA seqDB search
MQTEGGYNEGGKGKSVYDTYQATENSSDWKVGIDNYHHYQEDFDLMAEMGLNSYRFQISW
SRVNPLGDGDFNEEGIAYYDQFINELLKRNIQPMICLYHFDMPLNLAQKYNGFLDRHVVD
AFARYGREMVKRFGDRVKYWITFNEQNLYSTSEAFKIAGYLKGNKTDSELYQISHHVMLA
HAQVTNYIHENTNCQIGGMLAYSEVYPVSPQPKDILYARQIDEFLNHNLLDVFVHGHYSN
EVMTYVKNHNIDMDFQEQDKEVIGKVKSDFIAFSYYQSATISSAIVPENTLPNYYLEAGF
KPNPFLKVSEWGWSIDPLGFRDVLTKVYDQYGVPMFPIENGIGVRETYNGTEIQDDYRIQ
YHQLHIQAMMDAMFEDGVSVIGYLGWGLIDIPSSSGNMEKRYGMVYVNRGNHDLRDMKRI
PKKSYWWFKNYLNQLKQN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagaaggggggtataacgaaggaggaaaaggaaaatctgtttatgatacatac
caggcgactgaaaatagttctgactggaaagtgggtatagataattatcatcattatcaa
gaagattttgatttaatggcagagatggggttaaacagttaccgatttcaaatatcatgg
agtcgagttaatcctctgggcgatggtgattttaatgaagagggaatcgcttactatgat
caattcattaatgaactgttaaaacgtaatattcaaccgatgatttgtttgtaccatttt
gatatgccactgaatttggcacagaagtacaacggatttttagatcgacacgttgttgat
gcttttgctcgatacggacgtgaaatggttaaacgttttggagatcgggtaaaatattgg
attacatttaacgagcagaatctatattcaacgtccgaggcttttaagattgcgggttat
ttaaaaggaaataaaactgatagtgaactttatcaaatatcgcaccatgtaatgctagcg
catgctcaagttactaattacattcacgagaatacgaactgtcaaattggtgggatgtta
gcctatagcgaggtttacccagtttcaccacaaccgaaagatattctctatgcaagacag
attgatgaattcttaaatcataatttattagatgtttttgtacatggtcattactctaat
gaagtaatgacatatgtaaaaaatcataatattgatatggactttcaagaacaggataag
gaagttattggtaaagtaaaaagtgattttattgcctttagttattatcaaagtgccacg
attagtagtgcaattgttccagagaatacacttcctaattactatttggaagctggattt
aaacctaatccgtttttaaaagtttcagaatggggttggtcgattgatccgcttgggttt
agagacgttttgacaaaagtgtatgaccagtatggggttccgatgttccctattgaaaat
ggaattggggtacgggaaacctataacggaactgagattcaggatgattatcgaattcaa
tatcatcagttacatattcaagcaatgatggatgcaatgtttgaagatggtgtctcagtg
attggatacttaggctgggggttaatagatatcccaagttcatcaggaaatatggagaaa
cgctacgggatggtttacgttaatcgtggtaatcatgatttacgtgatatgaagagaatt
cctaaaaaaagttactggtggtttaaaaactatcttaatcaacttaagcaaaattag

DBGET integrated database retrieval system