KEGG   Pediococcus claussenii: PECL_1502Help
Entry
PECL_1502         CDS       T01713                                 

Definition
aldose 1-epimerase family protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pce  Pediococcus claussenii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pce00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pce00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451216..1452220
Genome map
AA seq 334 aa AA seqDB search
MKFSKQGFGKTKWYTLTNDNQISITISNIGATVVAINTPDKNGNVENITLGFKTPEEYTK
HHDYFGATVARSAGRIGNAEWRDFKLDNDSEGNNIHGGNNPSISYERWTRISSFTRLHEV
GLVLKYLSHDGENGFPGNLTINAIFRLNNQNQFSVTYIGHTSKQTIFNPTTHIYFNLSGN
NKRTIDDELLTVDSSSITELDKQKVPTGNLLNVDNTPFNFQSRQQLAGALSKIENGLDTP
YIVQPSKEHPQLQLNDPTSGRKLKVQTSANSLVLFSSTGFNGEFIVNGTREMTSQLGLAI
EPQMLPDAVHHSGFGNVIISPSKPMMYQNVYYLN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtaagcaagggtttggcaaaacaaaatggtacaccctaacaaatgataac
cagatctcaatcactatcagtaacatcggagctaccgtagttgcgatcaacacgcctgat
aaaaatggtaacgttgaaaatatcacactcggatttaaaacacctgaagaatataccaaa
catcacgattattttggtgcaaccgttgcacgctctgcaggacgtattggaaacgctgaa
tggcgcgattttaagctagacaatgatagtgagggcaacaatattcacggaggaaataat
ccgtctatcagttatgaacgctggactcggatcagctcgtttacacgtctgcatgaagtt
ggactagtcttaaaatatttaagtcacgacggtgaaaatggatttcccggtaatttaacg
atcaacgcaattttcagacttaataatcaaaaccaattttcagttacctatattggtcac
acatcaaaacaaaccatctttaatcctactactcatatttatttcaacctaagtggtaat
aacaagcgaactattgatgatgaactactaaccgttgacagcagttcaattaccgaactt
gacaaacaaaaggttccaaccggaaacctattaaatgtagacaacacgccctttaatttt
caatcccgtcagcaattagctggtgccctctcaaaaattgagaacggtcttgataccccc
tatatagtccaacctagtaaagagcatccccaattacagctaaacgacccaacgtccggt
cgtaaacttaaagtacaaacctctgccaattccttggtattgttctcttcaaccggattt
aatggtgaattcatagttaatggcaccagagaaatgacctctcagcttggtttagcaatt
gagccacaaatgttaccagatgcagttcatcattctggcttcggtaacgttattatttca
ccgtctaaaccaatgatgtaccaaaacgtttattatttaaattaa

DBGET integrated database retrieval system