KEGG   Pediococcus claussenii: PECL_1521Help
Entry
PECL_1521         CDS       T01713                                 

Gene name
bglH
Definition
aryl-phospho-beta-D-glucosidase BglH
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pce  Pediococcus claussenii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pce00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1471008..1472465)
Genome map
AA seq 485 aa AA seqDB search
MYSKEFPKAFPKGFLWGGATAANQIEGAWNVADKGLTTAEVVKKAKNHADITLSSVSDES
IQEAINDHSTKNYPKRRGIDFYDHYKEDIKLFAEMGFKAFRLSIAWARIFPQGDEAEPNE
AGLKFYDDVFDELAKYGIEPVVTLSHYEMPLGLTLKQNGWESRATIDNFLRFTKVVFSRY
RTKVKYWMTFNEINAATWGFVGTGAVDTDKTTEEQLQIRYQSVHHQFVASALAVKQGHEI
NSNFKIGSMLARGVSYPKTSNPVDVRAAQVVDQQNLFFTDIQVRGEYPEYMNRYFAEHNI
VIEMNEDDEQILKEGTVDYLSFSYYMSNVTSASGKADGAGNMILGEQNPYLETSDWGWQI
DPIGLRITLNELWDRYRVPLFVVENGLGAHDELEADGHVHDSYRIDYLKRHIEQMKEAIE
DGVDLMGYTMWGPIDLISASTSEMSKRYGFIYVDQDDDGNGSLKRIRKDSFEWYKKVLES
NGEDL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtactcaaaagaatttccaaaggcatttccaaaaggctttttatggggaggtgcaact
gctgctaaccagattgaaggagcttggaacgttgctgataagggattaacaaccgcggaa
gttgttaagaaagccaaaaatcacgctgatatcacgttgagtagtgtttcagatgaaagt
attcaagaagctataaatgatcattccaccaaaaattatccgaaacgtcgtggaattgat
ttctatgaccattataaagaagatattaaactgtttgctgaaatgggattcaaggcgttt
cgtttgtcgattgcttgggcgcgaatttttccacaaggcgatgaagctgagcctaacgag
gcaggtttaaaattttatgacgatgtttttgatgaattggctaaatatggaattgaaccc
gtggtgactttatcacattatgaaatgccactgggattaactctcaagcaaaatggctgg
gagagtcgagctacgattgataattttttgcgctttactaaagtggtatttagtcgctat
cgaactaaagtgaagtactggatgacttttaatgaaattaatgctgctacatggggattt
gtaggaacaggagccgttgatactgataaaacaactgaagagcagttacaaattcgttat
cagtctgttcaccaccaatttgtagcaagtgcacttgcagtcaaacagggacatgagatt
aattcaaactttaaaatcggcagtatgttggcgcgaggagttagttatccaaaaacttct
aatccggtcgatgttcgggctgcacaagtggttgatcaacaaaatctcttttttacagat
atccaggttcggggcgaatatccagagtatatgaacagatattttgctgaacacaatatt
gtgatcgaaatgaacgaagatgatgaacagattttgaaagagggaaccgtcgattacttg
agctttagttactatatgtcaaacgttacttcagcgtctggcaaagctgatggagcaggt
aatatgattttgggtgaacagaatccatatcttgaaacaagcgattggggttggcaaatt
gacccaattggattacgtattaccttgaatgaattatgggaccgctacagagtgccgtta
tttgtcgttgaaaatgggttaggtgctcatgatgaattagaggcggacggacatgttcat
gattcgtatcgaattgactaccttaaacgccatattgagcaaatgaaagaagcgatcgaa
gatggtgttgatttgatggggtatacaatgtggggaccaattgatttaattagcgcgtca
acttctgaaatgtcgaaacgttatggatttatctatgtggatcaagatgatgatggcaac
ggatctttaaagagaattagaaaagattcatttgaatggtataaaaaagtgttggaaagt
aacggggaagatttatag

DBGET integrated database retrieval system