KEGG   Pediococcus claussenii: PECL_1606Help
Entry
PECL_1606         CDS       T01713                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pce  Pediococcus claussenii
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PECL_1606 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    PECL_1606 (thlA)
   00640 Propanoate metabolism
    PECL_1606 (thlA)
   00650 Butanoate metabolism
    PECL_1606 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    PECL_1606 (thlA)
   00072 Synthesis and degradation of ketone bodies
    PECL_1606 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PECL_1606 (thlA)
   00310 Lysine degradation
    PECL_1606 (thlA)
   00380 Tryptophan metabolism
    PECL_1606 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PECL_1606 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PECL_1606 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PECL_1606 (thlA)
Enzymes [BR:pce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PECL_1606 (thlA)
Exosome [BR:pce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PECL_1606 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1544745..1545908
Genome map
AA seq 387 aa AA seqDB search
MKNVYIVSAGRTPIGKMGGVLADLSAVNLGTLMIAELLKRAHVSADDVDEVLLGNVLQAG
NGQNPARQAALNAGLPNSVVALTLNAVCGSGLESINQAAKLIAMGDIKVAIAGGMESMSN
APYLLRKARFGYRLGNDELVDSMMNDALTDAFNNYPMGITAENVATLKKVSKHEMDIFAI
NSQNKAVLAQTNGSFSEEIIPVKISNKTINLDEAPRPHLDINKLDNMKPAFKPDGVVTAA
NSAGINDGAAGVLLMDEDTMHHLGLTPIAKWNYGTMAGIDPTIMGLGPINSTQKLMEHES
ISINDIDLFEVNEAFAAQAIPVISTLKIPTNKVNIHGGSIALGHPVGASGARILVSLIYA
MKQKNAKTGVATLCIGGGMGCSTLISR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtttacattgttagtgctggtcgtaccccgattggaaagatggggggagtt
ttagcagacctttctgccgttaacctaggaactctgatgattgcagagctattaaagcga
gcgcacgtatctgctgacgacgttgacgaagtattgctgggaaatgtccttcaggctggt
aacggacaaaacccagcaaggcaagccgccttaaacgcagggttacctaacagtgttgtt
gctcttaccctaaatgccgtttgtggatcaggactagaaagtatcaatcaagctgccaaa
ttgatcgcaatgggtgacattaaagttgcaattgctggtggaatggagagcatgtcaaat
gcaccttatttgttacgcaaagcacgttttggatatcgtctgggaaatgacgaattggtt
gattcaatgatgaacgatgcgttaacagatgcttttaataactatcccatgggaattaca
gccgaaaatgttgccacattaaaaaaagtatctaagcatgagatggatattttcgcaatt
aatagtcaaaacaaagcagttctggctcaaactaatggaagcttttccgaagaaattatt
cccgttaaaatttccaataaaacaattaatttagacgaggctccgcgtccacatttggat
attaataaacttgataatatgaaaccagctttcaaacctgatggagtcgtaactgctgct
aactccgctggaatcaatgacggggctgcaggcgtcttactaatggatgaagatacaatg
catcacctaggtcttactccaattgctaaatggaattatggtaccatggcaggaattgat
ccaactataatgggacttggcccaattaactccacccaaaaactaatggaacacgagagc
ataagcattaatgatattgacctttttgaggtaaatgaggcttttgctgcccaagctatc
cccgtaattagcaccctcaagattccaaccaacaaagtcaatattcatggtggatccatt
gccttaggccatcccgttggggcatctggcgctcgcatactggtttctctaatttacgca
atgaaacaaaaaaacgccaaaactggcgttgctacactctgtattggtggtggaatgggg
tgttctaccttaatatctagatga

DBGET integrated database retrieval system