KEGG   Pediococcus claussenii: PECL_1636Help
Entry
PECL_1636         CDS       T01713                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pce  Pediococcus claussenii
Pathway
pce00010  Glycolysis / Gluconeogenesis
pce00260  Glycine, serine and threonine metabolism
pce00680  Methane metabolism
pce01100  Metabolic pathways
pce01110  Biosynthesis of secondary metabolites
pce01120  Microbial metabolism in diverse environments
pce01130  Biosynthesis of antibiotics
pce01200  Carbon metabolism
pce01230  Biosynthesis of amino acids
Module
pce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pce_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PECL_1636 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PECL_1636 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PECL_1636 (gpmA)
Enzymes [BR:pce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PECL_1636 (gpmA)
Membrane trafficking [BR:pce04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PECL_1636 (gpmA)
Exosome [BR:pce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PECL_1636 (gpmA)
  Exosomal proteins of melanoma cells
   PECL_1636 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEV95853
UniProt: G8PAY5
Position
complement(1573331..1574020)
Genome map
AA seq 229 aa AA seqDB search
MAKLVLIRHGQSQWNLSNQFTGWVDVDLSDEGVKQAQNAGKLIKDAGLEFDYAYTSVLTR
AIKTLHYALEGSDQLWIPETKTWRLNERHYGALQGQNKAEAAKKWGDDQVHIWRRSYDVL
PPLLDASDEGSAANDRRYANLDPRIIPGGENLKVTLERVIPFWEDEIAPKLLDGKNVIIA
AHGNSLRALSKYIENISDEDIINLEMATGEPVVYDFNDKLEVQNKTKLN
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagtattgattcgtcacggacaaagtcaatggaatttatctaaccaattt
actggttgggttgatgttgaccttagtgatgaaggtgtaaaacaagcacaaaacgctgga
aagttaatcaaagatgcaggacttgaatttgactacgcttatacttcagtattaactcgt
gctatcaaaacattgcactatgctcttgaaggctcagaccaactttggatccctgaaaca
aagacatggcgtttgaacgaacgtcattatggtgcgcttcaaggccaaaacaaggctgaa
gcagctaaaaaatggggcgatgaccaagtacatatatggcgtcgttcatacgatgttctt
cctccattgttggatgcaagtgacgaaggatcagcagctaacgatcgtcgttacgcaaac
ttagacccacgcatcatccctggtggtgaaaatcttaaggttactttggaacgtgttatt
ccattctgggaagacgaaatcgctcctaagttacttgacggcaagaacgttatcattgca
gcacatggtaactcacttcgtgctttgagcaagtacatcgaaaacatttcagacgaagat
atcatcaaccttgaaatggctactggtgaaccagttgtttatgacttcaacgacaagctt
gaagtacaaaataagacaaagcttaactag

DBGET integrated database retrieval system