KEGG   Pediococcus claussenii: PECL_259Help
Entry
PECL_259          CDS       T01713                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pce  Pediococcus claussenii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PECL_259 (glgB)
Enzymes [BR:pce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PECL_259 (glgB)
Exosome [BR:pce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PECL_259 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256015..257928
Genome map
AA seq 637 aa AA seqDB search
MKIEQKRFEKQAYLFNVGEYFKSYEFLGCHSVNDQINMFSFTVWAPNAKQVQVISSAKDW
KQPISMRKIGQTGIWTVETKDVHSGDLYKFQITDQQGNVFQKIDPYGFQFEKKPGNAAIV
ADNKQRKWHDQKWLKARSEKQVLNEPLNIYELHAGSWRRHKDDSYYTYAELADELIPYVK
KHGYTHIELLPIMEHLLDASWGYQQMGYFAPTSRFGNLNQFLEFIDRCHQVNIGVIVDWV
PGHFIKNYDSLYQFDGTPTFEYSERERAENKRWGSWNFDLGKNQVQSFLISSAMYWIDYC
HLDGLRVDAVSNMLYLDYDEGKEGITNHLGDNRNLEGISFLQKLNTVIFAEHPDILMIAE
ESSAFPKVTAPVSSGGLGFNLKWNMGWMNDTLKFFEMDPLFRKDNFKLLTFAFMYMYDEQ
FVLPFSHDEVVHGKKSLMHKMPGDRYNQFANLRTMLAYQACFPGKKLNFMGSEWGQFLEW
RDWSQLEWVDLKDDMNLKTQSYTTKLNELYRENESLWQQDFSPNGMNFTNTDDAESSTMT
FIRQSEKSTDFIVCAFNFVPIERQKYRIGVPYSGEYELLLNTEDINYGGTWTKLEKEFHT
KRIPFTGQSYSFTVTLPAMGALLIRPINLKEDINNER
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgagcaaaaaagatttgaaaaacaagcatatttatttaacgttggtgagtat
tttaaaagctacgaatttttagggtgtcactctgttaatgatcagataaacatgtttagt
tttacagtttgggcaccgaatgcaaaacaggtacaagtgattagttctgcgaaagattgg
aaacagccgatctcaatgcgaaaaataggacaaactggcatttggacagtcgaaacaaaa
gatgttcactcgggagatttgtataagtttcaaattactgatcaacaagggaatgtattt
caaaaaattgatccttatggatttcagttcgaaaaaaagccagggaatgctgcaattgtt
gcggataacaaacaaagaaaatggcatgatcagaagtggctgaaagcacgcagtgaaaag
caggttttgaacgagcctttaaacatttacgagttacacgctgggtcgtggcgacgacat
aaggatgatagttattacacttatgcagagttagcagatgaattgataccatacgtaaaa
aaacatgggtatacccatatagaacttttgccaattatggagcatttattggatgcgtcc
tggggttatcaacaaatgggatactttgcaccaaccagccgttttggaaatttgaatcag
tttttggagtttattgatcgatgccatcaagtaaatattggagtgattgttgattgggtt
ccaggtcactttataaaaaattacgattcgttgtatcagtttgatggaacacccactttt
gagtattcagagcgtgaacgtgcggaaaataagcggtggggttcatggaacttcgatctt
ggaaagaaccaggtgcagagctttttgatttcaagtgcaatgtattggattgattattgc
cacttagatggtttacgcgtggacgccgtttctaatatgttgtatttggactatgacgaa
ggtaaagaaggaataacgaatcaccttggtgataatcgtaatttggaaggaatttcattt
ttacaaaagctcaatacggttatctttgcggaacatcccgatatattgatgatcgcggaa
gagtcatctgcgtttccaaaagttacggcaccagtctctagtggtggattaggttttaac
ttgaagtggaatatggggtggatgaacgatactctgaaattctttgagatggatccactg
tttagaaaggataattttaaattattaacctttgccttcatgtacatgtatgacgaacaa
tttgtgttgccattttcgcatgatgaggtagttcatggtaaaaagtcattaatgcacaaa
atgcctggtgatcgatacaaccagtttgctaatttaaggacaatgctggcatatcaagct
tgctttccaggtaaaaagttaaactttatgggaagcgaatggggacaatttcttgaatgg
cgagactggagtcagctagagtgggtggatttaaaagatgatatgaatcttaaaacgcag
tcctatacgacaaaactaaacgaactgtatagagaaaatgaatcactgtggcaacaggat
ttttcaccaaatgggatgaacttcaccaatacggatgacgctgaaagttcaacaatgaca
ttcatacggcaaagcgagaaatcaactgactttatagtttgtgcgtttaactttgtgccc
attgaacgacaaaagtatcgtattggcgtgccttattcgggagaatatgaattgctatta
aacactgaagacattaattacggggggacttggacgaaacttgaaaaggaatttcacact
aaaagaattccgtttactggacaatcgtatagttttacggtcacgttacccgcaatggga
gctttactaatcagacccattaatttgaaggaggatattaataatgaacgatga

DBGET integrated database retrieval system