KEGG   Pediococcus claussenii: PECL_369Help
Entry
PECL_369          CDS       T01713                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pce  Pediococcus claussenii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PECL_369
   01230 Biosynthesis of amino acids
    PECL_369
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PECL_369
  Energy metabolism
   00680 Methane metabolism
    PECL_369
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PECL_369
Enzymes [BR:pce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PECL_369
Exosome [BR:pce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PECL_369
  Exosomal proteins of melanoma cells
   PECL_369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374813..375490
Genome map
AA seq 225 aa AA seqDB search
MVKLVLIRHGESTANKNNEYTGWTDVPLTKSGIKQAHVAGKLLADANIDFTMVHTSMLKR
AIVTANIILDETRQNWLPIQKSWRLNERHYGALRGLNKSDTRKVYGAEQVALWRRSFSAV
PPLLDHAEYDRRYAINGIMQEPLGESLKMAYNRLIPYWIDQVAPRLLDNQNQLIVAHGST
LRALIKYLENISDDGIDGVEVENGQPIVYQFDSQLKILTKEIWGS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaattagttttgatccgacatggtgaaagtacagctaataagaataatgagtat
accggttggacggatgtccctcttacaaaaagtggcattaaacaggcacatgtggcgggt
aagttacttgcagatgcgaatattgattttactatggtgcacacttcaatgctgaaaaga
gcaattgtaactgctaatattattttagatgaaactcgccagaactggttaccaattcaa
aagtcatggcgattaaatgaacgacactatggcgcgcttcgtggattaaataaatcagat
acgagaaaagtttatggcgccgagcaagttgcattatggcggcgaagcttttctgcagtt
cctccgttattggatcatgcagaatatgatagacggtacgctataaacggaattatgcaa
gagcccttaggggaaagcctgaaaatggcttacaatcgtttaataccatattggatcgat
caggttgcaccacgactgttagataatcaaaatcaactaattgtggcgcatggaagtaca
ttgcgggcgttgattaaatacttggaaaacatttcagatgatggaattgacggtgttgag
gttgaaaatggtcaaccaattgtgtatcaatttgatagtcagctaaaaatccttactaag
gaaatatggggtagttga

DBGET integrated database retrieval system