KEGG   Pediococcus claussenii: PECL_451Help
Entry
PECL_451          CDS       T01713                                 

Definition
aldehyde dehydrogenase family protein
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pce  Pediococcus claussenii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PECL_451
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PECL_451
   00620 Pyruvate metabolism
    PECL_451
   00650 Butanoate metabolism
    PECL_451
  Lipid metabolism
   00071 Fatty acid degradation
    PECL_451
  Amino acid metabolism
   00350 Tyrosine metabolism
    PECL_451
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PECL_451
   00626 Naphthalene degradation
    PECL_451
Enzymes [BR:pce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PECL_451
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PECL_451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
451079..453622
Genome map
AA seq 847 aa AA seqDB search
MVSRSHVALDKLESFTQEQVDKICEAVALAGLENHMKLAKMAVEETGRGVVEDKAIKNIY
ASEYIWNSIRNDKTVGIINDDDEKQIIEIAEPLGVIAGVTPVTNPTSTVVFKTLLALKTR
NTIIFGFHPQAQKSCVETGKILEKAAVEAGAPENSIQWIEEPSIEATNALMNNDGVASVL
ATGGPGMVKAAYSTGKPALGVGPGNGPAYIEKSANIKRSVNDIVLSKTFDNGMVCASENS
AVVDAEIYNEVKKEFQALGCYFVKKSEIDALSETVMDPERHTVRGPIAGKSAFTIAKMAG
IDVPEDTKVLIAEINGVGVDYPLSGEKLSPVLSMYKVKGHDEAFERCEELLNYGGLGHTA
ALHTTDDNLITEFGLRMKACRILVNTPSAIGGIGNIYNNMVPSLTLGTGSYGKNSISHNV
TDFDLLNIKTIAKRRNNMQWVKLPPKVYFERNSIRYLETMEGIKKAFIVCDPGMMKLGFT
DRVVAELNKRVDAPEIEIFSDVEPNPSTNTVYRGVDQMRSFEPDTIIALGGGSAMDAAKG
MWLFYEHPEASFMAAKQKYLDIRKRTYKVPTPSKAKYIGIPTTSGTGSEVTPFAVITDSE
THVKYPIADYALTPDVAIVDSQFIETVPPRTTALTGLDVICHATESFVSVMATDYTKGWS
LQALKLAFKYLKPAYDGDLVARQKMHDASTIAGMAFANAFLGINHSIAHKLGGEFDLPHG
LCIAMTYPHVIRYNAKTPRKLAMWPLYEHFTADEDYAEIARYLGLKGRTTEELVESLSQA
YIDLAHSMDVNLSLKGNGVTKEHFDKSAQKLAELSYEDQCTPANPKEPLISELKEIIDKE
YEGIDVE
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggtttcacgctcgcacgtagcactcgataagttggaaagttttactcaagaacaagtc
gataagatttgtgaagcggttgctttggcaggactggaaaatcacatgaagttagccaaa
atggctgttgaagaaacgggccgtggtgtggttgaagacaaagctattaaaaatatatac
gctagtgaatatatttggaacagtatccgtaatgataaaactgttggaattattaatgat
gatgatgagaaacaaatcattgaaattgcagagcctcttggggtaattgcaggagtaaca
ccagtaacaaacccaacatcaacagttgttttcaaaacattacttgccttgaaaacgcga
aacacaattatttttggattccatccacaagcacaaaagtcttgtgttgaaacaggaaag
attttagaaaaagctgcagttgaggctggtgcacctgaaaattcaattcaatggattgaa
gaaccaagcattgaagcaactaacgctctaatgaataacgatggtgtggcttcagtttta
gctacaggtggtcctggcatggttaaagcggcatattcaactggaaaaccagcacttggt
gttggccctggtaatggtccggcatatattgaaaaatctgcaaacattaagcgttcagtt
aatgatattgttctttcaaaaacatttgataacggtatggtttgtgcatctgaaaatagt
gcagttgtggatgctgaaatttacaatgaagttaaaaaagaatttcaagcgctcggatgt
tattttgtaaagaagagtgaaattgacgcactctcagaaactgttatggatccagaacgt
catacggttcgcggcccaattgctggtaagagtgctttcactattgctaagatggctggt
attgatgttccagaagatactaaagttttgattgctgagatcaatggtgttggcgttgac
tatccattatcaggtgagaaactttcaccagttctttcaatgtacaaggtaaagggacat
gatgaagcatttgaacggtgtgaagagttattgaattatggtggacttggtcatactgca
gcattacacacaaccgatgacaatttaattactgagtttggacttcgtatgaaggcatgt
cgtattttggttaatacaccatcagccattggtggtattggtaatatctataacaatatg
gttccatcattaacattaggaacaggatcatatggtaaaaactcaatttcacataacgta
acagattttgatttactaaatattaaaacaatagctaagcgtcgcaataatatgcagtgg
gtgaagctccccccaaaagtatacttcgagcgaaactcgattcgttatttggagacaatg
gaaggtattaagaaagcatttatcgtttgtgaccctggaatgatgaagttaggttttacc
gaccgcgttgttgccgaattaaacaaacgtgttgacgctcctgaaattgaaattttctct
gatgttgaacctaacccttcaactaatacagtttatcgtggtgttgatcaaatgcgctcg
tttgaaccagatacaattattgcgcttggtggtggttcagcgatggatgctgctaagggc
atgtggttattctatgaacatccagaggcatcattcatggccgcaaaacagaagtattta
gatattcgtaaacgtacctataaagtaccaaccccaagtaaggctaagtatatcggtatt
ccaacaacatcaggtactggatcagaagttacaccatttgctgttattacggattcggaa
acccatgttaaatatccaattgctgattatgccttaacaccagatgttgcaatcgtggat
tctcaatttatcgaaactgtaccaccacgcacaacagcgctaacaggactagatgtgatc
tgtcatgcaactgaatcatttgtatctgtgatggcaacggattacacaaagggatggtca
ctacaagcccttaaattagcatttaaatatttgaagcctgcgtatgatggtgacttggta
gctcgtcaaaaaatgcacgatgcttcaacaattgctggtatggcctttgctaatgcgttc
ttaggaattaatcattcaatcgctcacaagcttggtggtgagttcgacttaccacatggt
ttgtgtattgcaatgacatatccacatgttattcgctacaacgctaagacacctcgtaag
ttggctatgtggccactgtatgaacactttacggctgatgaagattatgctgaaattgct
cgctaccttgggttaaagggtcgaacaacggaagaactagttgaaagcctctcacaggcc
tatatcgatttggcacacagcatggatgtaaacttgagcttgaaaggtaatggcgttact
aaagaacattttgataaatctgcgcaaaaattagccgagttatcatatgaagatcaatgc
acaccggctaaccctaaagagccacttatttctgagttgaaagaaattatcgacaaggaa
tatgaaggcattgatgttgaatag

DBGET integrated database retrieval system