KEGG   Pediococcus claussenii: PECL_498Help
Entry
PECL_498          CDS       T01713                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pce  Pediococcus claussenii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PECL_498 (recR)
DNA repair and recombination proteins [BR:pce03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PECL_498 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502361..502960
Genome map
AA seq 199 aa AA seqDB search
MQYPEPIAKLIDSFMKLPGIGYKTATRLAFFTLDMQGDDVTEFAKSLINVQRNLHFCSIC
GNITEEDPCEICSDPSRDQNTVLVVEDSKDVMSMEQMKEYHGLYHVLHGVLSPMEGKGPE
DINITSLLKRLQDNEAIKEVIIATNATPEGEATAMYLARLVKPSGIKVTRLAHGLSVGSD
IEYADQMTLYKAVEGRTEM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatccagaaccaattgcaaaattaattgatagctttatgaaattgccagggatt
ggttataagacggcaactcggttagcattctttactttagatatgcagggtgacgatgtg
actgagtttgctaaatcattgataaatgttcaaagaaatctacatttctgtagtatttgt
ggcaatattacggaggaagatccctgtgaaatttgttcagatccttcgcgcgatcaaaat
actgttttagttgttgaagattctaaagacgtaatgtcaatggaacaaatgaaggaatat
cacggattataccatgttctacacggtgtcctatctccgatggaaggaaagggacctgaa
gatattaatatcacaagtttattaaaacggcttcaggataatgaagcaattaaagaagtg
attattgcaactaatgcaactcctgagggtgaagcaaccgcgatgtatttagcacgattg
gttaaaccgtcgggaattaaggttacaagattagcacatgggttatctgttggaagtgac
attgaatatgcggatcaaatgactttatataaagctgtagagggaagaactgaaatgtag

DBGET integrated database retrieval system