KEGG   Pediococcus claussenii: PECL_535Help
Entry
PECL_535          CDS       T01713                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pce  Pediococcus claussenii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PECL_535 (galU)
   00052 Galactose metabolism
    PECL_535 (galU)
   00500 Starch and sucrose metabolism
    PECL_535 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PECL_535 (galU)
Enzymes [BR:pce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PECL_535 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
537221..538105
Genome map
AA seq 294 aa AA seqDB search
MAKIKKAIIPAAGLGTRFLPATKASPKEMLPIVDKPTIQYIVEEAKKSGIEDILVVTGKG
KRAIEDHFDSVPELEDNLRSKGKDKMLKLVEETTDINLYFIRQSHPRGLGDAVLTAKAFV
GDEPFVVMLGDDLMEDKIPLTKQLINSYEVTGASTLAVMPVPHKEVSKYGVIDPQEKLND
NLYNVARFVEKPAVEEAPSDLAIIGRYVLTPEIFDILEQQKPGEGNEIQLTDAIDTLNKR
QRVFAHVFNGDRYDVGNKFGFLKTNIEFGLKHPETKDELKEYIIQLGKDLDKKK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaataaagaaagcaattattcctgcagctggtttgggtacaaggttcttacct
gcaactaaggcatctccaaaggaaatgctacctatcgtggataaaccaaccattcagtat
attgttgaagaagcaaaaaaatcaggtattgaagatattttagtcgtcacaggtaaagga
aagcgtgcgattgaagaccattttgattctgttcctgaacttgaagataatttaagaagc
aaaggtaaagataaaatgttgaaattggttgaagagacaactgatatcaatctatatttt
attcgccaaagtcatccccgtggacttggcgatgccgttttaactgcgaaagctttcgtt
ggtgacgagcctttcgttgtaatgcttggtgatgacttgatggaagacaaaattccgctg
accaagcaactgattaattcatacgaagtaactggcgcttcaactcttgctgttatgcca
gtaccacacaaggaagtttcaaaatatggtgtgatcgatcctcaagaaaaattaaatgat
aatttatataatgttgcacgttttgttgagaagccggccgttgaggaagctccaagcgat
ttagcaatcattggacgatatgttctaacgcctgaaatttttgatattcttgaacaacag
aaacctggcgaaggtaatgaaattcagttaacagacgcgattgatactttgaataagagg
caacgggtatttgctcatgtatttaatggtgatcgttacgatgttggtaataaatttggt
ttcttaaagactaatatcgaatttgggttaaagcacccagagactaaggatgaattaaag
gaatatattattcaacttggaaaagatttagataaaaagaagtag

DBGET integrated database retrieval system