KEGG   Pediococcus claussenii: PECL_550Help
Entry
PECL_550          CDS       T01713                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pce  Pediococcus claussenii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PECL_550 (tpiA)
   01230 Biosynthesis of amino acids
    PECL_550 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PECL_550 (tpiA)
   00051 Fructose and mannose metabolism
    PECL_550 (tpiA)
   00562 Inositol phosphate metabolism
    PECL_550 (tpiA)
Enzymes [BR:pce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PECL_550 (tpiA)
Exosome [BR:pce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PECL_550 (tpiA)
  Exosomal proteins of bladder cancer cells
   PECL_550 (tpiA)
  Exosomal proteins of melanoma cells
   PECL_550 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
556835..557590
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKMNKNPEETQAFLEAIKGKLPDANVVESVIAAPAIDLNALVWFSKDENLK
TAAENSYFEDEGAFTGETSPKALSEMGVDYVVIGHSERRQYFHETDEDINKKAKAIFRNN
MTPIVCCGETLEQREAGETNDFVAGQITNALKDLSADQVASLVIAYEPIWAIGTGKTATS
DQAQEVCHVVRETVAKLYNDEVAGKVRIQYGGSVKPANIVELMGKEDIDGGLVGGASLDP
ESFLQLVNYKG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtactccaattattgctggaaactggaaaatgaacaaaaaccctgaagaaacacag
gctttcttagaagctatcaagggtaagttaccggatgctaacgtcgttgaatctgtaatt
gcagcccctgcaattgatttaaacgctttggtttggttctctaaagacgaaaacttaaag
actgctgctgaaaacagttactttgaagatgaaggtgcttttactggtgaaactagtcct
aaagctctttcagaaatgggtgttgattacgttgtgattggacattcagaacgtcgtcaa
tatttccatgaaactgacgaagatattaacaagaaggctaaggctatttttcgtaacaac
atgactccaatcgtgtgctgtggcgaaactttggaacaacgtgaagctggcgaaacaaat
gattttgtcgctggtcaaatcacgaatgctttaaaggatctttctgcagaccaagttgct
tcacttgtaattgcctacgaaccaatttgggcaatcggtactggtaaaacagctacaagt
gaccaagcacaagaagtatgtcacgtagttcgtgaaacagttgcaaaactttacaacgac
gaagttgctggtaaggttcgtattcaatatggtggtagtgttaagcctgctaacattgtt
gaattaatgggcaaggaagacattgatggtggacttgttggtggtgcatcacttgatcca
gaatcattccttcaattagttaactataagggttaa

DBGET integrated database retrieval system