KEGG   Pediococcus claussenii: PECL_654Help
Entry
PECL_654          CDS       T01713                                 

Definition
mur ligase middle domain protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pce  Pediococcus claussenii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pce00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pce00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(668955..670304)
Genome map
AA seq 449 aa AA seqDB search
MSLKSSFAKFAGKSSYWFLHTFRSGGSSFPGKITTKIDPDILKSLGKDYDVIVITGTNGK
TLTTALTVKVLRQKYEHVLTNPTGSNMEQGIVTTFLTDHKTKNGKNLAILEVDEANVIKV
TKYIKPLAFVFTNIFRDQMDRYGEIYTTYQKILDGVALAPEATIIANGDMPIFNSKKLPN
PIIYYGFNDRPDGELRAHYNTDGVLCPVCQHIIHYKFITYSNQGKYYCPNCGWHRPELRY
QVTALSKLTPNNSKFFIDGSNFNIHIGGLYNIYNALAAYSVGKFMGVSTSAIQKALNDPD
ERVFGRQEQINVDGKEVTIVLVKNPVGLNQVIDMVGTETEPFSFVGLLNANYADGLDTSW
IWDGNFEKLTTMNIKQYVTGGERYKDITFRLKVAGVQDNQLETYNNLKDAVANIKNLPTK
RVYVFATYTAMLQLRKQLATDGYIKEGIA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttaagagttcatttgctaaatttgctggaaaatcttcttactggtttttacac
acttttcgttctggtggaagttcttttcccggaaaaattaccacaaaaatcgatcctgat
attttaaaaagtttgggtaaagactatgatgtcattgtcattactggtacaaacggaaaa
actctaacaaccgctctcactgtcaaagttttacgccaaaagtacgaacacgtattaaca
aatccaactggttcaaatatggaacaaggtattgtcacaacatttttaactgatcacaaa
accaaaaatggtaaaaatttggcaattcttgaggttgatgaagcaaatgtcattaaagtc
actaaatatatcaaaccactcgcgtttgtttttaccaatatttttcgggaccaaatggat
cgctatggtgaaatttatacaacataccaaaagatattggacggcgtggcattagctccg
gaagctactataattgccaacggtgatatgccaatcttcaattccaaaaaattacctaat
ccaattatttattatggctttaatgatcgtccagatggtgaactacgtgcccattataat
acagacggtgtgctctgtccggtctgccaacatatcatccattacaagtttattacctat
agtaatcagggaaaatattactgtccaaactgtggatggcatcgcccagagttgcgttac
caagtcactgcgctctctaagctaacacctaataattcaaagttctttattgatggtagc
aactttaacattcatattggtgggctttataatatctacaatgcgctggcagcatattcc
gtgggtaagtttatgggagtttcaacttctgcaattcaaaaagccttaaatgatcctgat
gaacgtgtctttggtcgtcaagaacagattaatgttgatggtaaagaagtcacaattgta
ttagttaagaacccagttggactaaaccaagtcattgatatggttggtaccgaaactgaa
ccattttcgtttgtcggtcttttaaatgctaactacgccgatggtcttgacacgagttgg
atttgggacggtaactttgaaaaattaacaacgatgaatattaagcaatatgtaaccggc
ggagagcgctataaagatattactttccgcttaaaagttgctggggttcaagataaccag
cttgaaacctacaataatttaaaagatgcagttgcaaatattaagaatttacccacaaaa
cgcgtttatgttttcgcaacttacacagctatgttacaattgcgcaaacaattagcaaca
gatggttacatcaaggagggaatcgcataa

DBGET integrated database retrieval system