KEGG   Pediococcus claussenii: PECL_78Help
Entry
PECL_78           CDS       T01713                                 

Definition
glycosyl hydrolase family 3, N terminal domain containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pce  Pediococcus claussenii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PECL_78
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PECL_78
Enzymes [BR:pce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PECL_78
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
80260..81378
Genome map
AA seq 372 aa AA seqDB search
MGIGIISVIFMLFLIGKGERPIKEHIEVKKVTVEEKIQKKVKSMTLDEKIGQLFVPEASS
DDVANAYNIKKYHLGGMLLMGNAYMGDRAQFKAKIKQFQKNAQIPLTISTDQEGGLVSRL
SYNPAISKRSYYPSPQEAYQTGGMKNVKYWYSQTAIDLKSLGINWNFAPIADVSLDPNNY
IFGRTIGKGYKGTGDYIKDVIPEIQKHNVAASLKHFPGYGTAANTHVGSATSYKSVAQYE
KEDFVPFKDGIKAGADSIMVTHIIMSKVDPYVPASLSKKDIDLLRKELHFKGVIVSDSLQ
MGAVSDYVALTGISRDVTAFRAGNDVLLSDDFVQGIPEIKQAITDKQISMKRLDKSVERI
LMMKHKIGLKVY
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgggtattgggattatcagtgtcatatttatgttgtttttaattggaaaaggtgaaaga
ccgattaaagaacatattgaagttaaaaaggtaactgttgaagaaaagattcaaaaaaag
gtaaagagtatgacgctagatgaaaaaataggtcagctatttgtgcctgaagcttcaagc
gatgacgttgctaatgcttataatattaaaaaatatcatctcggtggtatgttgctaatg
ggaaatgcttacatgggagatcgagcccaatttaaagctaagattaaacaatttcaaaaa
aacgcccaaattccacttactatttctacagaccaagaaggtggcttggtatcaaggtta
agttacaatcctgcaatttcgaagagaagttattatccatcacctcaagaggcatatcaa
actggtggaatgaaaaacgttaaatattggtattcgcaaacggcaattgatctaaagtcg
ttaggaataaattggaattttgcaccaattgccgatgtttctttagatcctaataattat
atttttggtagaacgattggtaaaggatataaaggtactggtgactacataaaagatgtc
attccagaaattcaaaaacacaatgttgccgcatctttaaaacattttcctggttacgga
actgctgccaacacacacgtcggttctgcgacatcatataaatccgttgctcagtatgaa
aaagaggactttgtaccattcaaagacggaatcaaggcaggtgcggattcgattatggtt
acgcatattattatgagtaaagttgatccttatgtaccagcctccttatcaaagaaagac
attgatttactacgaaaagagctacactttaagggagtaattgtgtctgatagtttgcaa
atgggagccgtgtctgattatgtggcattaactggaattagtagggatgttacagcgttt
agagcgggaaatgacgttttactatctgacgattttgtacagggaattccagaaataaaa
caggctattactgacaaacaaatatcaatgaagcgattggataaatctgtcgagcgaatt
ttgatgatgaaacacaaaataggattgaaagtatattaa

DBGET integrated database retrieval system