KEGG   Pediococcus claussenii: PECL_823Help
Entry
PECL_823          CDS       T01713                                 

Definition
viral (Super1) RNA helicase family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pce  Pediococcus claussenii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PECL_823
Enzymes [BR:pce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PECL_823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
821857..824256
Genome map
AA seq 799 aa AA seqDB search
MAEEINLFRNNDTEKVSQAHLVGSIAGIFFESPDSFFKVVLVDVDENDFDWEEDQIVATG
SFADLQEGESYSFIGRVVNHPKYGQQLQVETYSRTQPTSLDGLITYFSSSVFKGIGKKTA
EKIVNTLGTNAIDMISSDKSVLKGLGLSTKQQDTIYDVISQSDGMEKIIAGLSAYGFGST
IAARIFKKYQEKTLSIIEEDPYQLAIDIEGIGFKKADQLARQFGIGFDFASRIDAGILHV
INEWYNNTGNTYIVSKDLVMQVSNLLEVDGQNVDLEKIADQVIELAKKDRIVGDDNRVYL
KWMYNAELIIAGKIKLLTNQKDVKVPAGLFKKLIRNAEKKINVKYDDTQRNAILNSLKSP
ISIITGGPGTGKTTIIKGFLQTYADLHELSLDPNQYTDSHFPIMLAAPTGRAAKRITEVT
NVPAKTIHRLLGINGNDSLTSDEELELSGGLLIVDEMSMVDVALFKKLIQATDTSVQVVL
VGDQDQLPSVGPGQVFHDLIKSDCIPTVKLNNVHRQSSDSTITDLAHAIQKGQLPEDFTQ
NKSDRSFFTAHANQVEDIIEQVVDRAMDRGFSKADIQVLSPMYRGSAGVDQLNKHLQRIM
NPPLQPNPKKIMVRDQEFRIGDKVLQLVNAPENNVFNGDIGEIVGMVSKGANQHIIVNFD
ETEVTYSKTDWNQLTLAYCISIHKSQGSEFKMIIMPLVNQFSRMLQRNLLYTGITRASSF
LILLGEQSAYQTAVEHVASNRKTTLILRLTGIYEEDSSSELDDGQNVKVEESRVKVSIIN
NNVDPMIGMKGISPYDFMN
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaattaatttatttagaaataatgacacggaaaaggtatcacaagcccac
ttagttggttcgattgcagggatttttttcgaaagccctgattctttttttaaggttgtt
ttagttgacgttgatgagaatgattttgattgggaggaggatcagattgttgcgacaggt
agttttgctgacttacaagagggtgaatcatatagctttattggaagggttgttaaccat
cctaaatatggacaacaattgcaggtggaaacgtacagtagaactcagccaactagttta
gatggtctaattacttatttttctagtagtgtttttaaaggaattgggaaaaaaacagct
gaaaagattgttaatacattaggaactaacgctattgacatgatttcctctgataaaagt
gtattaaaaggtttagggttatcaacgaagcaacaagatacaatttatgacgtgattagt
cagtccgacggtatggaaaaaatcattgcgggattgagtgcatacggatttggaagtacc
attgctgctcgtatatttaagaaatatcaagaaaaaaccctatcaatcatcgaagaggat
ccttatcaacttgcgattgacattgaagggattggttttaagaaggctgatcaacttgca
aggcagtttggaattggttttgactttgctagtagaattgatgctggaattttgcatgtc
attaatgagtggtataacaataccggaaatacatacattgtttcgaaagatttagtgatg
caagtttctaatttgttggaagtggatggacaaaatgttgacctagaaaaaattgctgac
caagttattgagttagcaaaaaaggatcgaattgttggggatgacaatcgagtatatctg
aaatggatgtataatgcggaattgattattgcaggtaaaatcaaattacttactaatcaa
aaagacgttaaagtacctgctggattatttaaaaagcttattcgaaatgctgaaaaaaag
attaatgttaagtatgatgatacgcagagaaatgccattttaaattcgttaaaatcacct
atttcaattataactggcggacctggtactggtaaaacaactattattaaaggcttttta
cagacgtatgctgatttacatgaactttcgctagatcctaatcaatatacagacagtcat
tttccaattatgttggcggcaccaactggacgggcagctaaaagaattacagaagtaaca
aatgttcccgctaagaccattcaccgtttgttaggaatcaacggtaatgatagtttaacc
tctgatgaagagcttgaattaagtgggggactattaattgttgatgagatgtcaatggta
gatgttgctctttttaaaaaactaattcaggcaacagatactagtgtgcaagttgttctt
gttggggatcaagatcaattgccttctgtcggacccggacaagtttttcatgatttaatt
aagagtgattgtattccaacagttaaattaaataatgtacaccgtcaaagtagtgattca
acaattactgacctggcacacgcaatccaaaaaggacaattaccagaggactttacacaa
aataaaagtgatagatcattttttacagcgcatgcaaatcaggtagaggatatcattgaa
caagtcgtcgatcgagccatggaccgaggttttagtaaagctgatattcaggtgttgtca
cccatgtaccgtggtagtgcaggtgttgatcagttgaataaacacttacaacggatcatg
aatccgccgttacagccgaatcctaagaaaataatggttagagatcaagaatttagaatt
ggtgataaagttttgcaactagttaatgctccagaaaataatgtttttaacggcgatatc
ggcgaaattgtaggaatggtttctaagggtgctaatcagcatatcatagttaattttgat
gaaactgaagtgacttatagtaaaactgattggaaccaattaaccttggcatattgcatt
tctatccataaatcacaaggtagcgaatttaagatgataataatgccacttgttaatcag
ttttcaagaatgttgcaacgaaatttgctgtatacgggaattacgcgagcttcgtctttt
ttaatactattgggtgaacaaagtgcctatcaaactgctgttgagcacgttgcctcaaac
cgtaaaacaactcttattttgagattaacaggtatctatgaagaagatagttctagtgaa
ttagatgacggacaaaatgtaaaagtagaagaaagtagagtgaaagttagtattattaat
aataatgtagatccgatgattggcatgaaaggcatttccccttatgatttcatgaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system