KEGG   Pediococcus claussenii: PECL_893Help
Entry
PECL_893          CDS       T01713                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pce  Pediococcus claussenii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PECL_893 (pfkA)
   01230 Biosynthesis of amino acids
    PECL_893 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PECL_893 (pfkA)
   00030 Pentose phosphate pathway
    PECL_893 (pfkA)
   00051 Fructose and mannose metabolism
    PECL_893 (pfkA)
   00052 Galactose metabolism
    PECL_893 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PECL_893 (pfkA)
Enzymes [BR:pce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PECL_893 (pfkA)
Protein phosphatases and associated proteins [BR:pce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PECL_893 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893876..894847
Genome map
AA seq 323 aa AA seqDB search
MKRIGILTSGGDAPAMNAAIRAVARKAISSGLEAYGINYGFAGLVAGDIHKFEATDLDNS
IDTGGTLLYSARYPEFAQEEGQLKGIEQLKKFGIDALVVIGGDGSYHGALRLTEHGYNTI
GLPGTIDNDIPYTDFTIGFDTALNTAVDAIDKIRDTAKSHQRVFAIQVMGRFAADIALWA
GVASGADAVIAPGFDYSVEKIANKLKKNRANGKDYGLIVIAEGDANSDAAPEFIDQLKQY
GDFDARATVIGHVQRGGVPSARDRVLASKMGAYAVELLLEGRGGLAVGILDNKVQAHDIT
DLFDAKHQADLSLHQLAEDLSFK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtattttaactagcggtggcgatgctccagctatgaatgctgcaatt
cgtgccgttgctcgtaaggccatcagttctggtcttgaggcttatggtattaactatggt
ttcgctggcttagttgctggtgacatccataaatttgaagcaacagatcttgataattca
attgatacgggtggtacattgctttattctgcccgttaccctgagtttgcgcaagaagag
ggtcaattgaaaggaattgaacaacttaagaaattcggaattgatgctcttgttgttatt
ggtggcgatggttcatatcacggggcacttcgcttaaccgaacatggatataacacaatt
gggttacccggtacaattgataacgatattccatatacagattttacaattggttttgat
actgctcttaatacggctgtagatgcaattgataagattcgtgacacggccaaaagtcat
cagcgtgtttttgccattcaggtgatggggcgttttgctgctgatattgctctttgggca
ggtgttgcttctggtgctgatgcagttattgcaccaggatttgattatagcgttgaaaaa
attgctaacaagcttaagaaaaatcgtgcaaacggtaaagattatggtttgattgtaatt
gctgaaggcgatgctaattcggatgctgcacctgaatttattgatcaactcaagcaatat
ggtgattttgatgcccgagctacagttattggacacgtacaacgtggtggagttccatca
gctcgtgaccgtgtgctagctagcaagatgggggcatatgcagttgagcttctacttgaa
ggtagaggtggccttgctgttgggatccttgataacaaggttcaagctcatgatattaca
gatctttttgatgcaaaacatcaagcagatctttcattacatcaattagctgaagatctt
tcatttaaataa

DBGET integrated database retrieval system