KEGG   Pseudomonas cichorii: PCH70_03030Help
Entry
PCH70_03030       CDS       T03002                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pci  Pseudomonas cichorii
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pci00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PCH70_03030
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PCH70_03030
   00310 Lysine degradation
    PCH70_03030
Enzymes [BR:pci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PCH70_03030
    2.6.1.48  5-aminovalerate transaminase
     PCH70_03030
Amino acid related enzymes [BR:pci01007]
 Aminotransferase (transaminase)
  Class III
   PCH70_03030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
303657..304937
Genome map
AA seq 426 aa AA seqDB search
MSNTNESLMQRRQNAVPRGVGQIHPIFAASAKNATVTDVEGREFIDFAGGIAVLNTGHLH
PKIIAAVQEQLTKLSHTCFQVLAYEPYVELCEKINARVPGDFAKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGVFRALYPCELHGVS
VDDSIASIERIFKNDAEPKDIAAIIIEPVQGEGGFYVAPKAFMLRLRELCDKHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPVACAAALAVLEVFEEENLLARCNTVGEHLVSGLKAIQAKYPVIGEVRALGAMIAVEL
FEDGDSHKPNAAAVAQVVAKARDKGLILLSCGTYGNVLRVLVPLTAEDELLNKGLAILEE
CFAELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatacaaacgaatccttgatgcaacgccgccagaacgctgtcccacgtggcgtt
ggtcagatccacccgatctttgccgcatcggcaaagaacgccaccgttaccgacgtcgaa
ggtcgtgagttcatcgacttcgcgggcggtatcgcagtactgaacaccggtcacctgcac
ccgaaaatcatcgccgccgtacaagagcaactgaccaagctgtctcacacctgcttccag
gtactggcttacgagccgtatgtagagctgtgcgaaaaaatcaacgctcgggttccaggt
gatttcgccaagaaaaccctgctggtgaccaccggttccgaagctgtggaaaacgccgtc
aagatcgctcgcgcagcgactggccgcgcaggcgtgattgccttcaccggtgcctatcac
ggtcgtaccatgatgaccctggggctgactggtaaagtcgtgccttactcggccggcatg
ggcctgatgccgggcggtgtgttccgcgccctttacccgtgcgagctgcatggtgtgagc
gttgatgactccattgccagcatcgagcgcatcttcaagaacgacgcagagcccaaggat
attgccgctatcatcatcgagcctgtgcagggcgaaggtggtttctatgtggcaccgaag
gcgttcatgctgcgtctgcgtgagctgtgcgacaagcacggcattctgctcatcgctgat
gaagtgcagactggcgctggccgtaccggcactttcttcgccatggagcagatgggcgtt
gctgccgatctgaccacctttgccaagtccatcgcaggcggtttcccgctggcgggcgtt
tgcggcaaggccgagtacatggatgccatcgctccaggcggtctgggcggtacttatgcc
ggcagcccggtagcctgtgccgcggccctggctgttctggaagtgtttgaagaggaaaac
ctgctggcgcgctgcaacacagtgggtgagcacctggtttccggtctgaaagccatccag
gccaaatacccggtcatcggcgaagttcgtgccttgggcgcaatgatcgctgtcgagctt
tttgaagatggtgacagccacaagccaaacgctgctgctgtcgctcaggttgtggccaag
gcccgtgacaagggtctgatcctgttgtcgtgcggtacttatggcaacgtcctgcgcgtt
ctggtgcctctgacggccgaggatgagctgctgaacaaaggtctggctattctggaagag
tgtttcgcagagctggcctga

DBGET integrated database retrieval system