KEGG   Pseudomonas cichorii: PCH70_03740Help
Entry
PCH70_03740       CDS       T03002                                 

Definition
MutM protein (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pci  Pseudomonas cichorii
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pci00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PCH70_03740
Enzymes [BR:pci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PCH70_03740
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PCH70_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
390308..391120
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTRRGIAPHLEGQRVSRVIVRDRRLRWPIPEDLDVRLSGQRIVEVGRRAKYL
LIQAEVGTLISHLGMSGNLRLVEAGLPALKHEHVDIELESGLALRYTDPRRFGAMLWSLE
PHSHELLVRLGPEPLTDLFDGERLYERSRGKSIAVKPFIMDNAVVVGVGNIYATEALFAA
GIDPRREAKGISRARYLKLAVEIKRILAYAIERGGTTLRDFIGGDGKPGYFQQELFVYGR
GEQPCKVCGTTLREVKLGQRASVYCPKCQT
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaagtcgaaaccacgcgccgtggcattgcgccccatctggaaggg
cagcgtgtcagccgcgtgatcgtgcgggaccggcgtttgcgctggcccatccccgaagac
ctcgatgtacgcctttccgggcagcgtatcgtggaagtcggccgacgggccaaatacctg
ctgatccaggccgaagtcggaacgctcatcagccatctggggatgtcaggtaacctgcga
ctggtcgaagctggcctgcctgcgctcaagcatgagcatgtggatatcgaactggagtcc
ggtctggcgttgcgctataccgatccgcgccgtttcggtgccatgctctggagccttgag
ccccacagccacgagcttctggttcgactggggccggagccactgacggatctgttcgac
ggtgagcgcctgtacgagcgctcccgaggcaagtccatcgcggtgaagcctttcatcatg
gataacgcggtggtggtcggcgtgggcaatatttatgcgaccgaagcgctgtttgctgcc
ggtatcgacccgcgacgcgaggccaagggcatttcccgggcgcgctatctgaagctggct
gtcgagatcaagcgcatcctggcctacgccatcgaacgcggcggcacgaccttgcgcgac
ttcatcggtggtgacggcaaacctggctatttccagcaggagctttttgtctacggccgt
ggtgagcagccatgcaaggtgtgcggcacgaccttgcgtgaggtcaagctggggcagcgg
gcaagcgtttactgccccaaatgccagacctga

DBGET integrated database retrieval system