KEGG   Pseudomonas cichorii: PCH70_08210Help
Entry
PCH70_08210       CDS       T03002                                 

Definition
peptidoglycan glycosyltransferase (EC:2.4.1.129)
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
pci  Pseudomonas cichorii
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pci00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PCH70_08210
Enzymes [BR:pci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     PCH70_08210
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     PCH70_08210
Glycosyltransferases [BR:pci01003]
 Polysaccharide
  Bacterial polysaccharide
   PCH70_08210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
910932..913184
Genome map
AA seq 750 aa AA seqDB search
MLKLSIVGFVALACVAVYLDAVVQEKFSGKRWTIPAKVYARPLELFVGQKLSRDDFLIEL
DALGYRRESVANGPGAAAVNGNTVDLNTRGFQFYEGTDPAQQVRVRFSGDYVADLTSGSS
GAKLAVARLEPLMIGGLYPKNLEDRILIKLDQAPPYLLDALVAVEDRDFYSHMGVSPKSI
ARAVWVNTSQGQMRQGGSTLTQQLVKNFYLTNERSLTRKLTEAMMSVLLELHYSKQEILE
AYLNEVFVGQDGQRAVHGFGLASQYFFSQPLSELKIHQVALLVGLVKGPSYYNPRRNPER
ALERRNLVLDLLEQQGVATAQVVEAAKKMPLGVTKTGSLADSSFPAFLDLVKRQLREDYR
DEDLTEEGLRIFTSFDPILQMKSQAAMDDTFKRLAGRKGADEVEAAMVVTNPETGEVQAL
LGSRQAGFAGFNRAIDAVRPIGSLVKPAIYLTALERPSQYTLTSWVADEPFQVKGADGQV
WKPQNYDRKAHGNIFLYQGLAHSYNLSTAKLGLELGVPNVFKTLAKLGVTREWPAYPSML
LGAGGLSPMEIATMYQTIASGGFNTPMRGIRSVLTAEGEPLKRYPFQIEQRFDPGAIYLV
QNAMQRVMREGTAKSVYSVLPSTLNLAGKTGTSNDSRDSWFAGFSQDLLAVVWMGRDDNG
KTPFTGASGALQVWTSFMRKADPLPLDMAMPDNVVQAWVNAQTGQGSDANCPNAVQMPYI
RGSEPQPGASCSGSPAPAAEVLDWVKGWLN
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaagctcagtatcgtcggttttgtggcgctggcttgcgttgccgtttacctggac
gcggtggtccaggagaagttttccggcaagcgctggaccattccggccaaggtctacgcc
cggcctctggaattgttcgtcggccagaaactgagccgcgatgacttcctcatcgagctc
gacgcgctgggctatcgccgcgaaagcgtggccaacgggccaggcgctgcagcggtcaat
ggcaatacagtcgatctcaacacccgtggttttcaattctacgaaggcactgatcctgcg
cagcaggtccgcgtgcgtttttccggcgactatgtggcggacctgacctctggtagcagt
ggtgcaaaactggcggtggcccgtctcgaaccgctgatgatcggcggcctgtatccgaaa
aatctggaagaccggatcctgatcaagctcgatcaggcacctccgtatctgctcgatgcc
ctggttgcagtcgaggatcgtgatttttacagccatatgggtgtatcgcccaaatccatt
gcccgtgctgtctgggtcaatacctcacaggggcagatgcgtcagggcggcagtacgctg
acccagcagttggtcaagaacttctacctgaccaacgagcgcagcctcacgcgcaagctg
accgaagccatgatgtcggtgttgctggagctgcattacagcaagcaggaaattctcgag
gcttacctcaacgaggtgttcgtcggtcaggacggtcagcgtgcggtgcatggtttcggt
ctggccagccagtacttcttcagccagccattgtcggagctgaagattcatcaggttgcg
ttgctggtcggcctggtcaaggggccttcctattacaacccgcgtcgcaatcccgagcgt
gctcttgaacgtcgcaatctggttctcgacttgctggagcaacagggtgttgctactgcg
caagtcgtcgaggccgccaagaagatgcctctgggcgtgaccaagaccggcagccttgcg
gacagttcgttcccggcattccttgatctggtcaagcgtcagttgcgtgaagactatcgc
gacgaagacttgaccgaagaagggctgcgaatcttcaccagtttcgatccgatcctgcag
atgaagtcccaagcggccatggacgacacgttcaagcgactggccgggcgtaaaggtgcg
gacgaagtggaggcggccatggttgtgaccaatcccgagactggcgaggtgcaagccttg
ctgggcagtcgtcaggccggattcgccgggttcaaccgcgctatcgatgccgtgcggcct
atcggctcgctggtcaagccggcgatctatctcaccgcgcttgagcgcccgagccagtac
accctgaccagttgggtggccgacgagccgtttcaggtcaagggtgcggacggccaggtc
tggaaaccacagaactacgatcgcaaggcccacgggaatattttcctgtatcaggggctg
gcgcattcctacaacctatcgacagccaagctgggtcttgagctgggcgtgcccaatgta
ttcaagaccctcgccaagctgggcgtgacacgcgaatggccagcgtatccttcgatgctg
ctgggggctggcggcttgagtccgatggaaatcgccaccatgtaccagacgattgccagc
ggcggcttcaataccccgatgcgtggtattcgcagcgtcttgactgccgagggtgaaccg
ctcaagcgttatccgttccagatcgagcagcgtttcgatccgggcgccatttatctggtg
cagaacgcaatgcagcgggtgatgcgtgaagggaccgccaagtcggtttacagcgtcttg
ccatcgaccttgaatctggcgggcaagaccggcaccagtaacgattcgcgcgacagctgg
tttgcaggtttcagtcaggatctgctggcagtggtgtggatggggcgtgacgataacggc
aagacgccgttcaccggagccagtggagccttgcaggtctggaccagtttcatgcgcaag
gccgacccgctgccgctggacatggcaatgccggataacgtggtccaggcctgggtcaat
gcccagaccggtcaggggtcggatgccaattgcccgaatgccgtacagatgccgtatatt
cgcggcagtgaacctcagcccggtgcctcctgtagcggtagcccggcacccgccgctgaa
gtgctggactgggtcaagggttggttgaattaa

DBGET integrated database retrieval system