KEGG   Pseudomonas cichorii: PCH70_12210Help
Entry
PCH70_12210       CDS       T03002                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pci  Pseudomonas cichorii
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCH70_12210
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCH70_12210
  Energy metabolism
   00680 Methane metabolism
    PCH70_12210
Enzymes [BR:pci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PCH70_12210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1362973..1365609
Genome map
AA seq 878 aa AA seqDB search
MADIDARLREDVHLLGELLGNTIRDQRGAAFLDKIERIRKGAKAGRRGSAAGAEQLSSSV
DSLDDDELLPVARAFNQFLNLANIAEQYQLMRRRDDTQPQPFEARVLPELLDRLKAEGHS
PDALARQLGKLEIELVLTAHPTEVARRTLIQKYDAIAAQLAALDHRDLNSIEREQITSRL
QRLIAEAWHTEEIRRIRPTPVDEAKWGFAVIEHSLWHAIPSYLRKADQALQAATGLHLPL
EAAPIRFASWMGGDRDGNPNVTASVTREVLLLARWMAADLFLRDVDQLAADLSMQQASDA
LRASVGESAEPYRAELKRLRERLRATRNWANASLTAPQPAPDAVLHDNRELLEPLMLCFQ
SLHDCGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSSRHCAAMTEITDYLGLGRYEDW
DEPTRIDFLLRELNNRRPLLPAHFKPAADTAEVLATCRVVAAAPAASLGSYVISMAGAAS
DVLAVQLLLKEAGLQRSMRVVPLFETLADLDNAGPVIERLLGLPGYRSRLHGPQEVMIGY
SDSAKDAGTTAAAWAQYRAQEKLVEICREQQVELLLFHGRGGTVGRGGGPAHAAILSQPP
GSVAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPLPEPSWRKMMDQMA
TDGVNAYRAVVRENPEFVEYFSQATPEQELGRLPLGSRPAKRRAGGVESLRAIPWIFAWT
QTRLMLPAWLGWEAALSKALERGEGDVLAQMREQWPFFRTRIDMLEMVLAKADSDIAQLY
DDRLVSAELQHLGAHLRGLLSQACKVVLGLTGQQQLLAHSPETLEFISLRNTYLDPLHLL
QAELLARSRYRESSLDSPLELALLVSVAGIAAGLRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatcgatgcgcgtttgcgcgaagacgttcacttgctgggcgagcttttggga
aacacgattcgcgatcagcgcggggccgcctttctcgacaagatcgagcgtattcgcaaa
ggggcgaaggccggcaggcgaggctctgcggcgggtgccgagcagttgagctccagtgtc
gacagcctggacgatgacgagctgttacccgtggcgcgagcgttcaaccagttcctgaac
ctggccaatatcgccgagcagtatcaattgatgcgccgtcgcgatgacacccagcctcag
cctttcgaggcccgggttctgcctgaactgcttgatcggctcaaggctgaaggccactct
cccgatgcgctggcccgccagttgggcaagcttgaaatcgaactggtacttactgcgcat
cccaccgaagtggcgcgccgcacgctgatccagaaatacgacgccattgcagcgcaactg
gcggcgctggaccatcgggatctcaatagcatcgagcgcgagcagatcacttccagactg
caacgactgatcgccgaagcctggcacaccgaagaaatccgccgtattcgccctacgcct
gtcgatgaggccaagtgggggtttgcggtcatcgaacattcgctctggcacgcgattcca
agctatctgcgcaaggccgatcaggcgctgcaagcggctaccggcctgcatttgccactg
gaagcggcgccgatccgctttgcttcgtggatgggcggcgaccgggatggcaaccccaat
gtcacggccagcgttacccgtgaagtcctgctgctggcccgctggatggcggccgatctg
ttcctgcgggatgtggatcaactggctgccgacctttccatgcagcaggccagcgatgcc
ttgcgcgccagcgtcggtgagagcgctgaaccctatcgtgctgaactcaagcgtttgcgc
gaacgtctcagggccacccgaaactgggccaatgcttcgctgaccgcgccacagcctgcg
ccggatgccgtgttgcacgataaccgtgaactgcttgaacctctcatgttgtgcttccag
tcgctgcatgactgtggaatgggagtgatcgccgatggcccgttgctcgattgcctgcgt
cgtgcggtgactttcgggctttttctggtgcgtctggacgtgcgccaggattccagccgt
cactgcgcggccatgaccgaaatcaccgactatctgggcctgggtcgttacgaggactgg
gatgagccgacgcgcatcgatttcctgctgcgtgaattgaataaccgtcgtcccttgctt
cccgctcatttcaaaccggctgccgacaccgccgaagttctggcaacgtgccgcgtcgtg
gcggctgcaccggcggcttcgctgggttcttacgtgatctccatggccggtgccgcatcg
gacgtgctcgcggtacaactgctgctcaaggaagctggcctgcaacggtctatgcgcgtg
gtgccgctgttcgagaccctggctgacctggataatgcggggcctgtgatcgagcggctt
cttgggctgccgggttatcgctcgcggctgcacggcccgcaggaagtgatgatcggctat
tcggattccgccaaggatgccggcaccactgccgcggcctgggcgcagtaccgggcgcag
gaaaaactggtggaaatctgccgcgagcagcaagtcgaactgctgttgttccatggccgt
ggaggcaccgtcgggcgcggtggtggtccggctcatgcggcgattctgtcgcaaccgccg
ggttcggttgcggggcgtttccgcacgaccgaacagggtgagatgattcgtttcaaattc
ggcctgcctgacattgccgagcagaacctcaacctttatctggctgccgttctggaagcg
accctgctgccacctcctttgcctgagccgtcctggcggaaaatgatggatcagatggcc
accgacggggtgaatgcctaccgggccgttgtgcgggaaaaccccgagttcgtcgagtac
ttcagtcaggccacgcccgagcaggaactgggtcgcctgccgctgggcagtcgcccggcc
aagcgtcgtgcgggtggtgtcgaaagcctgcgggccatcccgtggatcttcgcctggacc
cagacgcgcctgatgctgcctgcctggctcggttgggaagccgccctgagcaaggctctg
gaacgcggcgagggtgacgtgctggcgcagatgcgcgagcagtggccattcttccgcacc
cgcatcgatatgctggaaatggtgctggccaaggccgactcggacatcgcccagctctac
gatgaccgtctggtgagcgctgaactgcagcatttgggtgcgcatttgcgcggcctattg
tcgcaggcgtgcaaggttgtcctaggcctcaccgggcagcagcaactgctggcccatagt
ccggagaccctggaattcatcagtctgcgcaacacgtatctggacccgctgcatctgttg
caggccgagcttctggcgcgctcccggtatcgtgagtccagcctggacagtcctctggaa
ctggctttactggtgtctgttgcaggtattgcagccggattgcgcaataccggctga

DBGET integrated database retrieval system