KEGG   Pseudomonas cichorii: PCH70_24870Help
Entry
PCH70_24870       CDS       T03002                                 

Definition
alpha-amylase family protein
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pci  Pseudomonas cichorii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCH70_24870
Enzymes [BR:pci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PCH70_24870
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PCH70_24870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2826096..2829425
Genome map
AA seq 1109 aa AA seqDB search
MAKKKATNATFINDPLWYKDAVIYQVHVKSFFDSNNDGIGDFAGLIDKLDYIAELGVNTI
WLLPFYPSPRRDDGYDISEYRDVHSDYGTMADARKFIAQAHKRGLRVISELVINHTSDQH
PWFQKARHSKPGSKARDFYVWSDTDQKYEGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSH
QPDLNFDNPQVMDAVLDVMRFWLDLGIDGLRLDAIPYLIERDGTNNENLPETHQVLKRIR
AEIDAHYPDRMLLAEANQWPEDTQLYFGDTHGPNGDECHMAFHFPLMPRMYMALAQEDRF
PITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADKRARINLGIRRR
LAPLVERDRRRVELLNSMLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNG
GFSRADPASLVLPPLMDPLYGYQSVNVESQEKDPHSLLNWNRRMLAVRKQQKAFGRGTLK
MLSPSNRRILAYIREYTGSDGHNEIILCVANVSSAAQAAELELSAHAGTVPVEMLGGSAF
PPIGQLSYLLTLPPYGFYWFLLAPENQMPSWHVEPAQSMPDFPTLVLKKRLEELLDEPLR
STMESTSLAVYLPKRRWFAGKDKAIEQVNITYAVRFGDPSHPVLLSEIEVTAGGQPERYQ
LPFGLLAEDDISSALPQQLALARVRRGRQVGLITDAFTLETFIRAVIQGMQDQTVLTSSE
GELRFENTSELAPLGLSDESEVRYLSAEQSNSSVVVGSSLVLKLIRKVSAGIHPELEMGA
YLTNAGYRNISPLLGAVTRVGNDGQPHLLMIAQGYLSNQGDAWEWTQNNLERAVRDALAH
GVSEQEQHYNALLELADFSGYLGQRLGEMHQVLATPTDNPDFAVQVTSAKDSQASAKSVG
EQLDRALQLLDQRKDSLGADDQQLVSDLIARRKSIQNHVQDLAKRSVGGLRMRVHGDLHL
GQVLVVKGDAYLIDFEGEPARSLPERRAKHSPFKDVSGVLRSFDYAAAMAVRSAQSVDTS
QEAGVARQSVADTYLSQARESFLGGYRKATAGLAHEWKDKTGESAALELFTLEKAAYEVI
YEAENRPSWLAVPLQGLRGLLELSDGETK
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagaaagctactaacgccacattcatcaacgacccgctgtggtacaaggac
gcggtgatctatcaagttcacgtcaagtcgttcttcgactccaacaacgacggtatcggt
gactttgccggcctgatcgacaagctcgattacattgccgaactgggcgtcaacaccatc
tggctgttgccgttctatccctcgccacgacgtgacgatggctacgacatttccgaatat
cgcgatgtgcacagcgattacgggaccatggctgatgccaggaaatttatcgctcaggct
cacaagcgtggcttgcgggtcatcagcgagctggtcatcaatcacacctcggaccagcat
ccgtggttccagaaggcgcggcactccaagcccggctccaaggctcgcgacttttatgtg
tggtccgataccgaccagaagtacgaaggcacgcggatcatctttctggacacggaaaag
tccaactggacctgggacccggtggccggtcagtacttctggcaccgtttctactcccac
cagccggacctgaacttcgacaacccccaggtgatggatgccgtgctggacgtcatgcgc
ttctggctggacctgggaatcgatggcctgcgtctggatgccattccttatctgatcgaa
cgggatggcaccaacaacgagaacctgcccgagactcatcaggtcctcaagcgtatccgc
gccgagatcgatgcccattatccggatcgcatgctgctggccgaagccaatcaatggccg
gaggacacgcagctgtatttcggtgatacccatggacccaatggcgatgaatgccacatg
gcgtttcacttccctttgatgccgcgcatgtacatggcgctggcccaggaagaccgtttt
ccgatcactgacattctgcgccagacaccggaaattccggccaactgccagtgggcgatt
tttctgcgcaaccacgatgagctgaccctggaaatggtcaccgatcgtgagcgggactat
ctgtggaattactacgcggccgacaagcgtgcacgtatcaacctgggcattcgtcgacgt
ctggctccgctggtggagcgtgaccggcgtcgcgtcgaactgctcaacagcatgctgttg
tccatgccgggtacgccgacgctgtattacggcgatgaaatcggcatgggtgacaacatc
tacctgggcgatcgcgacggggttcgcacgccgatgcagtggtccatcgaccgcaatggc
ggtttctcccgggccgatccggccagtctggtattgccgccgctgatggacccgctgtac
ggctatcagtcggtcaacgtcgaaagccaggagaaagacccgcactccttgctgaactgg
aatcgccgcatgctggccgtacgcaaacagcagaaggccttcgggcgcggcaccctgaaa
atgctgtcgccgtccaatcgtcgcatcctggcctacattcgcgaatacacggggtcggat
ggacataacgagatcattttgtgcgtagccaacgtgtccagtgccgcccaggccgccgag
cttgagctgtcggcccatgcgggcactgttccggtggaaatgctcggcggcagtgctttc
ccgccgatcgggcaactgagttatctgctgacgctgccaccttatggtttttactggttt
cttctcgccccggagaatcaaatgcccagttggcacgtggaacctgcgcaaagcatgccg
gactttcccacgctggtactcaagaagcgtcttgaggagttgctcgacgagccgttgcgc
agcacgatggaaagcacctccctggcggtctacctgcccaagcgccgctggtttgcgggc
aaggacaaggctatcgagcaggtcaatatcacctatgccgttcgcttcggcgacccgtcg
catccggtcctgctcagtgaaatcgaggtcacggccggtggccagcctgagcgctatcaa
ctgcctttcgggctgctggccgaagacgacatcagcagtgccttgcctcagcaactggcg
ctggcccgtgtacgacgtggtcgacaagtaggtctgattaccgatgccttcaccttggaa
acctttatccgcgcagtgattcagggcatgcaggatcagaccgtactgaccagcagcgaa
ggcgaattgcgttttgaaaacacctcggagctggctccgctgggcttgagcgatgagtcg
gaggtgcgttacctgtccgccgagcagtccaacagctcggtggtggtgggcagcagtctg
gtgctcaagctgatccgcaaggtcagtgctggtattcacccggagctggaaatgggcgct
tacctgaccaatgccggttatcggaacatttcgcctttgctgggtgccgtgacccgagtc
ggcaatgacggacaaccgcacctgttgatgattgcccagggctacctgagcaatcagggc
gatgcctgggagtggacccagaacaacctggagcgggcggtgcgcgatgcactggcgcat
ggtgtgtccgagcaggagcagcattacaacgcattgctggaactggcggatttctccggt
tatctggggcagcggctgggagaaatgcaccaggttctggcaacacctaccgacaacccg
gacttcgcggtgcaagttaccagcgccaaggacagccaggcgtcggcgaaaagcgtcggc
gaacagcttgatcgtgccctgcagttgctcgatcagcgcaaggattcgctgggtgccgat
gatcagcaactggtcagcgacctcatcgcccggcgcaagtccatccagaatcatgtgcag
gatctggccaaacgctcggtgggcggtttgcgcatgcgtgtccacggcgacctgcacctg
ggccaggtattggtggtcaagggcgatgcctacctgatcgacttcgagggcgaacctgcc
cgcagcctgcccgagcggcgcgccaaacacagcccgttcaaggacgtcagcggcgttttg
cgctctttcgactacgctgccgccatggccgtgcgcagcgcacagagcgtggatacttcc
caagaggctggcgtggcccggcagtctgtggcagatacctatctgtctcaggcccgcgag
tcttttctgggcggatatcgcaaggcaaccgccggtctggcccatgaatggaaagacaag
acaggggagagcgcagcgctggaattgttcaccctggaaaaagctgcttatgaagtgatc
tacgaagccgagaatcgtccgagttggttggccgtgcctttgcaaggtttgcgtgggttg
ctggaattatccgatggagaaaccaaatga

DBGET integrated database retrieval system