KEGG   Pseudomonas cichorii: PCH70_28890Help
Entry
PCH70_28890       CDS       T03002                                 

Definition
(GenBank) carbohydrate kinase PfkB
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
pci  Pseudomonas cichorii
Pathway
pci00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PCH70_28890
Enzymes [BR:pci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PCH70_28890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AHF68042
UniProt: W0HB20
Position
complement(3438960..3439880)
Genome map
AA seq 306 aa AA seqDB search
MQAKIVIVGSLNMDLVIRAQRLPRPGETLAGESFMTVPGGKGANQAVAAARLGGSVAMIG
CVGEDAYGEQLRGALLAEGIDCRAVTSVSGVSTGIASIVVDDNSQNAIIIVAGGNAQLTP
SLIGVFDALLVAAEVVICQLEVPMETVHYTLSRARELGKTVILNPAPASSPLPQEWYGLI
DYLIPNESEAQALTGIVVDSPVSAQEAAKALLAAGARNVIITLGEQGSLLANAQGFEHVP
AQPVKAVDTTAAGDTFVGGFASALSQGRSESEAIRFAQVAAALSVTRAGAQPSIPTFDEV
QEFKAS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaaatagtgatagttggcagcctcaacatggacctggtgattcgcgcccag
cgtttgccgcgacccggtgaaacccttgccggagaatccttcatgaccgtgcccggcggc
aagggagccaatcaggccgtggcggctgctcgcctgggtggcagcgtggcgatgatcgga
tgcgtgggtgaagatgcctatggcgaacagttgcgcggcgcgttgctggcagaaggcatc
gattgtcgcgcagtcacgtcggtgtccggtgtgtccaccggtattgcctcgattgtggtg
gatgacaacagccagaacgcgatcattattgtcgccggggggaatgctcaactgacgcct
tctctgatcggggtgttcgatgcgctgttggtcgctgccgaagtggtcatatgccagctc
gaagtgccgatggaaacggtccactacaccttgtcccgtgcccgtgagctgggcaagacc
gtcattctcaatcctgcaccggcttcctcgcccttgccgcaagagtggtacgggttgatt
gactacctgattcccaatgaaagcgaggcgcaggcgctgacaggaatcgtggtggattcg
cctgtgtcggcacaggaggcggcgaaagcgctgctggcggccggggctcgtaatgtcatc
atcacattgggagagcagggtagcctgctggccaatgcccagggttttgagcacgtgcca
gcgcagccggtgaaggctgttgatacgaccgcggcaggtgatacctttgtcggcggtttt
gcctcggctctttcgcaaggcaggagcgagtccgaagcgatccgttttgctcaggttgcg
gcggcactgtctgttacccgtgccggtgctcagccttcgataccgacattcgatgaagtg
caggaattcaaagcctcatga

DBGET integrated database retrieval system