KEGG   Pseudomonas cichorii: PCH70_51080Help
Entry
PCH70_51080       CDS       T03002                                 

Definition
glucan 1,4-alpha-maltohexaosidase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pci  Pseudomonas cichorii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCH70_51080
Enzymes [BR:pci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PCH70_51080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(5907189..5908793)
Genome map
AA seq 534 aa AA seqDB search
MNLFKLGAISILLLVAQVSSAEDLRGNTPEGTRSDGNDEIVLQGFHWNSSRSSPGSWYST
LKTMAAQIRADGFTSVWMPVPWRDTSRWSDPGTGASGGGEGYFWQDFDKNSAYGSDAELR
QAVDALSAATVKVIYDVVPNHMDRQHVGPALKESLSDKTDWRDGCDQCDDGDPFMGGDAD
LNTQKPEVFNLFKNEFLNLRDHYSADGLRFDFVKGYSATTVDNWMKAFGDQHFCVGELWK
APNEYPANDWRHNATWQDGLKVWSDQSHCTVFDFALKERMQNAGLAEWRYGLNGNPDPAW
RAAAMTFVDNHDTGYSPGANGGQHHWSLPENLRDQAYAYILSSPGTPTVYWPDMYDWPRG
QLLRQLIEIRRTAGIKADSAISFMDNYSGLVAEVTGSHQMLLVALGSNFKSESVPGSFSQ
ALVAGDNGAIRIWRAKGVDVQFRCDKGETQVGEGVYVVGAGFELGEWNPARAVRLSDVSQ
YPVWKGQIRLADNTRYEWKCIVRSEADPNKVIKWQEGGNTVFVANEKGSSAATF
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttttcaagctcggtgcgatttcaatccttctgctggtggctcaggtctccagt
gcagaagatcttcgcggcaatacccccgagggcactcgtagcgatggcaatgatgaaatc
gtgctgcaggggtttcactggaattccagccgctcaagccccgggagttggtacagcacg
ctcaagaccatggctgcgcagatccgcgccgatggctttacctcggtctggatgccggtg
ccctggcgtgatacttcgcgctggagcgatccggggaccggtgcttcagggggtggcgag
gggtatttctggcaggacttcgacaagaacagtgcttatggcagcgatgccgaactccgg
caagcggtcgatgccttgagcgccgccactgtcaaagtgatctatgacgtggtgcccaat
catatggaccgccagcatgtcgggcctgcgctcaaggaatccctgagtgacaagacggat
tggcgtgatggctgcgaccagtgtgacgatggcgatccgttcatgggcggtgatgccgat
ctcaatacgcaaaagcctgaagtgttcaacctcttcaagaacgagttcctgaacctgcgc
gatcactattccgccgacggcctgcgtttcgattttgtaaaaggctacagtgcgacgacg
gtggataactggatgaaggccttcggcgatcagcatttctgtgtcggcgaactctggaaa
gcgccgaacgagtatcccgccaacgactggcgacataacgccacttggcaggatggtctg
aaagtctggtccgatcagtcgcattgcacggtattcgacttcgcgctcaaagagcgtatg
cagaatgccgggctcgccgaatggcgatatggcctcaacggtaatcccgatcctgcatgg
cgtgccgctgccatgacctttgtggataaccacgacaccggttattcgccgggagccaac
ggcggccagcatcactggtcattacctgaaaatcttcgcgaccaggcctacgcctatatt
ctcagcagccccggaacgccaacggtgtattggccggacatgtatgactggccgcgtggc
caactgctgcgccagttgatagagatacgccgcactgcgggtatcaaggccgattccgcg
atcagctttatggacaactattcagggttggtggccgaagtgacaggctcgcaccagatg
ctgctggtagcgctgggctccaacttcaagagcgagagtgtgccgggcagtttcagccag
gcattggtggcgggcgacaacggtgccatacgaatctggcgggccaaaggggtcgatgtg
cagtttcgttgcgacaagggcgaaacccaggtgggcgagggcgtttatgtcgtgggggcg
ggcttcgagctgggtgagtggaacccggcacgggcggtgcgcctgagtgatgtgagccag
tatcccgtctggaaagggcagatccggcttgccgacaatacccgctatgaatggaaatgc
atcgtgcgcagcgaggctgacccgaacaaggtcatcaagtggcaggaaggagggaataca
gtgtttgttgcaaatgaaaaaggtagcagtgctgctaccttttag

DBGET integrated database retrieval system