KEGG   Pyrobaculum calidifontis: Pcal_0041Help
Entry
Pcal_0041         CDS       T00483                                 

Definition
PfkB domain protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pcal_0041
Enzymes [BR:pcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pcal_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
45295..46209
Genome map
AA seq 304 aa AA seqDB search
MLVASVGNLNFDVYLKVGELPGVDENVEAFDLYTGGGGSAANFAVAVARLGLGARFIGAV
GEDPLGEMALRELREEGVDISHVKRVPSARSGVVVVLVHLDGSKRMLSYRGANLGLSPSD
LTVEKFAGVRHIHLATGRVEIIARAREIAREVGATVSIDGGTALAKKGLDVVKSVAEGVD
VIFMNRAEARLLTGSSDKSAVKKLAEELKARELVVTLGPEGAVAYDGARLLQVDAFRVDA
VDTTGAGDAFAAAYIAMFLQGRDIYERLLFANAAAAIKVTRPGARSSPRRWEVVAFLESL
GYKI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgttagtggcctctgtcggcaacctgaacttcgacgtgtatttaaaggtgggcgaactg
cccggcgtagacgaaaacgtggaggcctttgacctctacaccgggggcgggggctccgcg
gccaacttcgccgtggccgtggcgaggctgggacttggggctaggttcatcggcgcagtg
ggggaggacccgctgggggagatggctctccgcgagctcagagaggagggagtagacatc
tcccacgtgaagagggtgcccagcgccaggtccggcgtcgtggtggtgctagtgcactta
gacgggtctaagcgcatgttgtcctacaggggggccaacctcggcctctcgccgagcgac
ctcactgtggagaaattcgccggggttagacacatccacttggctactggcagagtagag
ataattgcccgggctagggaaatagccagggaggtgggggccaccgtgtccatagacgga
gggacggccttggctaagaaggggcttgacgtggtcaaatccgtggccgagggagtagac
gtgatttttatgaacagggcagaggcccggctgttgaccggctcctcggacaagagcgcc
gtcaagaagctcgccgaggagctaaaggcgagggagctggtggtaacgctgggcccagag
ggcgccgttgcctacgacggagctaggcttttgcaagtcgacgcgtttagagtagacgcc
gtggacaccacgggcgctggcgacgcctttgccgccgcctacatcgccatgtttctacag
gggagagacatctacgagagactgctctttgccaacgccgcggccgccatcaaggtgacg
aggccaggcgcccgctcctcaccgcgccgctgggaggtggtggcgtttttagaatcgctt
ggctacaagatttaa

DBGET integrated database retrieval system