KEGG   Pyrobaculum calidifontis: Pcal_0166Help
Entry
Pcal_0166         CDS       T00483                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcal_0166
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_0166
   00620 Pyruvate metabolism
    Pcal_0166
   00640 Propanoate metabolism
    Pcal_0166
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pcal_0166
   00680 Methane metabolism
    Pcal_0166
Enzymes [BR:pcl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pcal_0166
Lipid biosynthesis proteins [BR:pcl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pcal_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(161185..163056)
Genome map
AA seq 623 aa AA seqDB search
MWKPEREHLEESNVAKTLAERGEPLEKFLEYTYTGDFWSWFESHVLGLRWARRYEKVLDL
SRGVQWPRWFVGGFLNIGDQVEESAQPLVKWEGEDGSAAEWSYSYVLYKARAVASWLKRA
GLRKGDRVAVYMPMVPEIVPVMLGIIRAGGIFVPLFSGFGREAIRIRLEDSEARFVFASD
VSYRRGREVDMLAELEAGLAKSVEAVVLHARARERKDYVDLGEVFRTGGDYVEVTEAEDP
MMLIYTSGTTGKPKATVHVHGGFPIKAAADVYFHFDLKRGETLTWVTDMGWMMGPWLVFS
AYLLRGSMAFFEGAPDYPKDRVWKFVERFKVKVLGMAATLTRHLRTIGAEPGEGAGELKA
FGNTGEPIDAESWWWLHKAGRGRAPIINYSGGTEISGGILGCYVVKPIKPTSFNGPSPGT
KAAVFTEDGKPAPPGVEGELVVLSVWPGMTRGFWRDPQRYLETYWSKWPGVWAHGDAAVV
DEDGYFYIVGRADDTLKVAGKRLGPAEVEGVLNSHPAVAESAVVGKPDPLKGEVPVAFVV
LKQGFQPSEELKRELAALAEKALGKAYGALEEIYFVKELPKTRNAKIMRRVIRAILLGKS
PGDLSALENPTAVEEIKKAIGRQ
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagcccgaaagagagcacttggaggagtccaacgtggctaagactctggcggag
aggggggagccgcttgagaaattcctggaatatacctacacgggggacttctggtcttgg
tttgagtcgcacgtcctggggctgaggtgggccaggcgttatgagaaagtactggacctc
tcccgcggtgttcagtggcctcgctggtttgtgggaggatttttaaacatcggcgaccag
gtggaggagtccgcccagccgctggtgaagtgggagggggaagacggttcggcggccgag
tggtcttactcctacgtgctctacaaggcaagggcagtggcctcttggctgaagagggcg
gggcttagaaagggggatagagtggccgtctacatgcccatggtgcccgaaattgtgcct
gtgatgctcggcatcattagggctggggggatttttgtgccgcttttcagcggcttcggc
agagaggccattagaattaggcttgaggacagcgaggcccgcttcgtctttgcctcagat
gtgtcgtataggagggggagggaggtggacatgttggccgagctggaggccgggttggcc
aagtctgtggaggccgtggtgctccacgcgagggccagggagaggaaggactacgtagac
ttgggcgaggtctttcgcacaggcggagactacgtggaggtcaccgaggcggaggacccc
atgatgctcatatacacctcgggcaccactgggaagcccaaggccacagtgcacgtccac
ggggggttccccataaaggccgccgccgacgtctacttccacttcgacctcaagaggggg
gagaccctcacctgggtcacagacatggggtggatgatggggccgtggctcgtcttctcg
gcgtatctgctgaggggctccatggccttcttcgagggagcccccgactaccccaaagac
agggtgtggaagttcgtagagcggtttaaggtaaaggtgctcggcatggccgccacgctc
acaagacacctccgcacaattggggcagagcctggggaaggggcgggcgagctgaaggca
ttcggcaacactggggagcccatagacgccgagagctggtggtggctgcacaaggccggg
agggggagggcgcccataataaactactcaggcggcacagagatctccggaggcatactg
gggtgctacgtggtaaagcccataaagcccacatccttcaacggcccctcgccggggaca
aaagccgccgtgtttacagaagacggaaagccggcgccgccgggggttgagggagagctg
gtggtgctgtccgtttggcctggcatgactaggggcttctggagggacccccagcggtat
ttagagacgtactggtccaagtggccgggggtgtgggcgcacggcgacgcggctgtggta
gacgaagacggctacttctacatcgtgggcagggcagacgacacgctcaaggtggctggg
aagcgcctaggccccgccgaggtggagggcgtgcttaactcccaccccgcagtggccgag
tcggctgtggtgggcaagcccgacccgctcaagggcgaggtgccagtggccttcgtagtg
ttaaagcagggctttcagccaagcgaagagcttaaaagagagctggcagcgctggcggag
aaggcgcttggcaaggcgtacggcgccttggaggagatatacttcgtgaaagagctcccc
aagactagaaacgccaaaatcatgaggagggtaataagggcaattctcctgggaaaaagc
ccaggcgacctctcagctctcgaaaaccccaccgccgtagaagagatcaaaaaggcaata
ggacggcagtaa

DBGET integrated database retrieval system