KEGG   Pyrobaculum calidifontis: Pcal_0375Help
Entry
Pcal_0375         CDS       T00483                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pcal_0375
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcal_0375
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pcal_0375
Enzymes [BR:pcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pcal_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
360378..361421
Genome map
AA seq 347 aa AA seqDB search
MEVVVGEKYWAPKGRGVWRYASMLPVKNGVTMGEGQTPLVPSTLKPNLYVKYDGANPTGS
FKDRGMALGVTVAKLSGANKVVVASTGNTAASAAAYAARAGLKCYVVLPRGNVARGKLMQ
AALHGAELVMLNGLFDKALEYVVNYGTKYAYPLNSFNPWRLEGQKTAAFEIYEEVGCPDY
VVVPVGNAGNISAIWKGFKELWELGLCKKLPKMVGVQAEGAAPIANAWAMGKRAPIFLDE
PHTVATAIKIGKPINWPKAVAAVEESGGLFVTVSDEEILRAQRLLASRDGLGAEPAGAAS
VAAALKLDLSGTVVAVVTGHALKDPDVVEISAREVRNADELVELLEK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttggaggttgtagttggcgagaagtactgggcccccaaggggcgcggcgtgtggagatat
gcgtctatgctccctgtgaaaaacggcgtgacgatgggggagggccagacccccctagtt
ccctccacgcttaagccaaacctctacgtgaaatacgacggagcaaaccccaccggcagc
tttaaagacaggggcatggcgcttggcgtcactgttgccaagctgagcggggcaaacaag
gtggtagtcgcctccactggcaacaccgccgcgtcggccgcggcctacgccgcgagggcg
gggctgaagtgctacgtagtgctcccaaggggcaacgtggcccgcggaaagctgatgcaa
gccgcactccacggggccgagctagtgatgttaaacggcctctttgacaaggcgcttgaa
tatgtggtaaactacgggacgaagtacgcctaccccctcaacagctttaacccgtggcgc
ctcgaggggcagaagaccgcggcctttgaaatatatgaagaggtggggtgccccgactac
gtggtcgtgcccgtggggaacgcgggcaacatctcagccatttggaaggggtttaaagag
ctgtgggagctgggcttgtgcaagaagttgcccaagatggttggcgtgcaggcggagggc
gcggcccctattgcgaatgcgtgggccatggggaagagggcccccatattcctcgacgag
cctcacaccgtggccaccgccattaagataggaaaacctataaattggccaaaggccgta
gccgccgtggaggagtcaggcgggctcttcgtaacggtgtccgacgaagagatcctcaga
gcgcagaggcttttggcgtctagagacggcttgggagcagagcccgccggcgcggcatct
gtggcagcggccctaaaactcgacttaagcggcaccgtcgtggccgttgttacggggcac
gcgcttaaggaccccgacgtggtcgaaatctcggccagagaggttagaaacgccgacgag
cttgtggagctgttggagaaatga

DBGET integrated database retrieval system