KEGG   Pyrobaculum calidifontis: Pcal_0380Help
Entry
Pcal_0380         CDS       T00483                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00010  Glycolysis / Gluconeogenesis
pcl00620  Pyruvate metabolism
pcl00640  Propanoate metabolism
pcl00680  Methane metabolism
pcl00720  Carbon fixation pathways in prokaryotes
pcl01100  Metabolic pathways
pcl01110  Biosynthesis of secondary metabolites
pcl01120  Microbial metabolism in diverse environments
pcl01130  Biosynthesis of antibiotics
pcl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_0380
   00620 Pyruvate metabolism
    Pcal_0380
   00640 Propanoate metabolism
    Pcal_0380
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pcal_0380
   00680 Methane metabolism
    Pcal_0380
Enzymes [BR:pcl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pcal_0380
Lipid biosynthesis proteins [BR:pcl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pcal_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABO07815
JGI: pcal0380
UniProt: A3MT48
Position
365502..367508
Genome map
AA seq 668 aa AA seqDB search
MQTIQKETELPFEEYIMNNKWQGRSIDVKSYWQFHAKSLENFEEFWASVAKELEWFKPWD
KVLDASNPPFYKWFVGGRLNLSYLAVDRHVKTWRKNKLAIEWEGEPVDDAGYPTDRRKLT
YYDLFREVNRVACMLKCNFGIKKGDRITLYLPMIPELPITMLAAWRIGAITNVVFSGFSA
DALAERINDSQSRIVITADGFWRRGKVVRLKEVVDQALEKASGVEHVIVYPRLGLKDTPM
TEGRDYLWTKVMQGIKPNVYIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHVYA
TMKWVFDIRDDDVYWCTADIGWVTGHSYVVLGPLLMGATNIIYEGAPDYPQPDRWWSIIE
RYGVTIFYTSPTAIRMFMRYGEEWPRRHDLSTLRIIHSVGEPINPEAWRWAYRVLGGEKV
AFGSTWWMTETGGIVISHAPGLYLVPMKPGTNGPPLPGFEVDVVDDSGKPVPPGVRGYLV
IKRPWPGMLHGIWGDPERYIKTYWSRFPGMFYAGDYAIKDQDGYIWVLGRADEVIKVAGH
RLGTYELESTLVGHKAVAEAAVVGVPDPVKGEVPIAFVVLKQGVAPSEELRKELREHVRK
TIGPIAEPAQIFFVTKLPKTRSGKIMRRLLKAVATGAPLGDVTTLEDETSVEEAKKAYQE
LRAEVEKA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccattcaaaaagagaccgaactaccattcgaggagtatataatgaataataag
tggcaggggaggtctatagatgtaaagagctattggcaatttcacgccaaatcgcttgag
aactttgaagagttttgggcctctgtagccaaggagcttgagtggtttaagccgtgggat
aaggtgctggatgcgtctaacccgccgttctacaagtggtttgttggaggccgcctcaac
ttgtcctaccttgcggtagataggcacgtaaagacgtggcgtaagaacaagctggccatc
gagtgggagggagagccggttgacgacgcagggtaccccaccgataggcggaagttgaca
tactacgacctattccgcgaggtaaaccgcgtcgcatgtatgctaaagtgcaactttgga
attaagaagggggacagaattaccctctacctccccatgatcccagagttgcctataaca
atgctagccgcttggaggataggggctattacaaacgtggtattttccggcttctcggcg
gacgcgcttgctgagcgcatcaacgactcgcagtctaggattgtgataactgccgacggg
ttctggcggagggggaaagtggtgagactaaaggaggtggtggaccaggccctggagaag
gccagcggcgtggaacacgtgattgtgtacccaagactggggctaaaggacacgcctatg
acagaggggagagactatctgtggactaaggttatgcaaggcataaagccaaacgtgtac
attgagccagagcccgttgagagcgagcacccatccttcatcttgtacacctctggcacc
acgggcaagcccaagggaattgtgcacgacaccggcgggtgggccgtccacgtatatgca
acaatgaagtgggtgttcgacatacgtgacgacgatgtgtactggtgcaccgcagacatt
ggctgggtgacgggccactcctacgtcgtgcttggcccactcctcatgggggccacaaac
ataatctacgagggagcacctgactatccacagccagaccgctggtggtctatcatagag
cgctacggcgtcacaatcttctacacctcgcccacggccattagaatgtttatgcgctac
ggcgaagagtggccaaggagacacgacctctccactctccgcattatacactcggtgggg
gagcccataaatcctgaggcttggcgctgggcctaccgcgtcttaggcggagagaaagta
gcctttggctccacttggtggatgactgagaccggcggcattgtgataagccacgcccca
ggcctctacctagtccccatgaagcctggcacaaacggcccgccgctacccggcttcgag
gtagatgttgtggacgattcggggaagcccgtcccgccgggcgtaagggggtacttagtc
atcaagaggccgtggcctgggatgctccacgggatttggggagaccccgagcgctacatt
aagacctactggtcgaggttcccggggatgttctacgctggcgattacgcgattaaggac
caggacggctacatatgggtgctgggccgcgccgacgaggtaataaaggtggctggccac
cgcttaggcacgtacgagctggagtccacgttggtgggccacaaggcggtggccgaggct
gctgtggtgggcgtgcccgacccagtgaaaggcgaggtgcccatagccttcgtggtactg
aagcagggggttgccccatcggaggaactacgcaaggagcttagggagcacgtgagaaag
accattggccccatcgcggagccagcccagatattcttcgtcacaaagttgcctaagact
aggtctgggaaaataatgcgccgcctgctcaaggccgtggccacgggggcgccgctcggc
gacgtgaccacgctcgaggacgagacctcggtggaggaggccaagaaggcctaccaagag
ctgagggctgaggtggagaaggcatga

DBGET integrated database retrieval system