KEGG   Pyrobaculum calidifontis: Pcal_0380Help
Entry
Pcal_0380         CDS       T00483                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pcl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcl00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pcl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pcl00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:pcl00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:pcl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
365502..367508
Genome map
AA seq 668 aa AA seqDB search
MQTIQKETELPFEEYIMNNKWQGRSIDVKSYWQFHAKSLENFEEFWASVAKELEWFKPWD
KVLDASNPPFYKWFVGGRLNLSYLAVDRHVKTWRKNKLAIEWEGEPVDDAGYPTDRRKLT
YYDLFREVNRVACMLKCNFGIKKGDRITLYLPMIPELPITMLAAWRIGAITNVVFSGFSA
DALAERINDSQSRIVITADGFWRRGKVVRLKEVVDQALEKASGVEHVIVYPRLGLKDTPM
TEGRDYLWTKVMQGIKPNVYIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHVYA
TMKWVFDIRDDDVYWCTADIGWVTGHSYVVLGPLLMGATNIIYEGAPDYPQPDRWWSIIE
RYGVTIFYTSPTAIRMFMRYGEEWPRRHDLSTLRIIHSVGEPINPEAWRWAYRVLGGEKV
AFGSTWWMTETGGIVISHAPGLYLVPMKPGTNGPPLPGFEVDVVDDSGKPVPPGVRGYLV
IKRPWPGMLHGIWGDPERYIKTYWSRFPGMFYAGDYAIKDQDGYIWVLGRADEVIKVAGH
RLGTYELESTLVGHKAVAEAAVVGVPDPVKGEVPIAFVVLKQGVAPSEELRKELREHVRK
TIGPIAEPAQIFFVTKLPKTRSGKIMRRLLKAVATGAPLGDVTTLEDETSVEEAKKAYQE
LRAEVEKA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccattcaaaaagagaccgaactaccattcgaggagtatataatgaataataag
tggcaggggaggtctatagatgtaaagagctattggcaatttcacgccaaatcgcttgag
aactttgaagagttttgggcctctgtagccaaggagcttgagtggtttaagccgtgggat
aaggtgctggatgcgtctaacccgccgttctacaagtggtttgttggaggccgcctcaac
ttgtcctaccttgcggtagataggcacgtaaagacgtggcgtaagaacaagctggccatc
gagtgggagggagagccggttgacgacgcagggtaccccaccgataggcggaagttgaca
tactacgacctattccgcgaggtaaaccgcgtcgcatgtatgctaaagtgcaactttgga
attaagaagggggacagaattaccctctacctccccatgatcccagagttgcctataaca
atgctagccgcttggaggataggggctattacaaacgtggtattttccggcttctcggcg
gacgcgcttgctgagcgcatcaacgactcgcagtctaggattgtgataactgccgacggg
ttctggcggagggggaaagtggtgagactaaaggaggtggtggaccaggccctggagaag
gccagcggcgtggaacacgtgattgtgtacccaagactggggctaaaggacacgcctatg
acagaggggagagactatctgtggactaaggttatgcaaggcataaagccaaacgtgtac
attgagccagagcccgttgagagcgagcacccatccttcatcttgtacacctctggcacc
acgggcaagcccaagggaattgtgcacgacaccggcgggtgggccgtccacgtatatgca
acaatgaagtgggtgttcgacatacgtgacgacgatgtgtactggtgcaccgcagacatt
ggctgggtgacgggccactcctacgtcgtgcttggcccactcctcatgggggccacaaac
ataatctacgagggagcacctgactatccacagccagaccgctggtggtctatcatagag
cgctacggcgtcacaatcttctacacctcgcccacggccattagaatgtttatgcgctac
ggcgaagagtggccaaggagacacgacctctccactctccgcattatacactcggtgggg
gagcccataaatcctgaggcttggcgctgggcctaccgcgtcttaggcggagagaaagta
gcctttggctccacttggtggatgactgagaccggcggcattgtgataagccacgcccca
ggcctctacctagtccccatgaagcctggcacaaacggcccgccgctacccggcttcgag
gtagatgttgtggacgattcggggaagcccgtcccgccgggcgtaagggggtacttagtc
atcaagaggccgtggcctgggatgctccacgggatttggggagaccccgagcgctacatt
aagacctactggtcgaggttcccggggatgttctacgctggcgattacgcgattaaggac
caggacggctacatatgggtgctgggccgcgccgacgaggtaataaaggtggctggccac
cgcttaggcacgtacgagctggagtccacgttggtgggccacaaggcggtggccgaggct
gctgtggtgggcgtgcccgacccagtgaaaggcgaggtgcccatagccttcgtggtactg
aagcagggggttgccccatcggaggaactacgcaaggagcttagggagcacgtgagaaag
accattggccccatcgcggagccagcccagatattcttcgtcacaaagttgcctaagact
aggtctgggaaaataatgcgccgcctgctcaaggccgtggccacgggggcgccgctcggc
gacgtgaccacgctcgaggacgagacctcggtggaggaggccaagaaggcctaccaagag
ctgagggctgaggtggagaaggcatga

DBGET integrated database retrieval system