KEGG   Pyrobaculum calidifontis: Pcal_0383Help
Entry
Pcal_0383         CDS       T00483                                 

Definition
ketopantoate reductase (EC:1.1.1.169)
Orthology
K00077  
2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Pcal_0383
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     Pcal_0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(370403..371245)
Genome map
AA seq 280 aa AA seqDB search
MKFGIIGLGAVGSLLAYFLNRAGYVPHVVTRSRRERYVLKWGGETHVLQVAVVDELPPVD
YTLVAVKAYDTEAVVDKIRGEPVVFQNGIGGLELLKERLGVGFGAVVTYGVSRVEGVAEV
RGVGEIVLPREAGEVADALRAGGARVRVVEDIEPARWLKLAINAAINPITALLRAKNGVV
VENPYAKSLAAEAAREAGRVAEAVGVRLPADPVEETLRVAEATRDNVSSMLQDLSQCRRT
EVDYINGAVVRLGERHGVEAPVNKALWALVKAAEAACGAV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattcggcattattgggctaggcgccgtcggctctctattggcgtacttcctcaac
agagccggctatgtgccccacgtggtaacgaggagtaggagagagcgctatgtgctaaag
tggggcggggagacgcacgtcctacaggtggccgtggtggacgagttgcccccagtggac
tacaccctagtcgccgtcaaggcctacgacacagaggcagtggtggacaagatacggggc
gaacccgtcgtcttccagaacggaattgggggcctggagttgctcaaggagagacttggc
gtgggcttcggcgcggtggtgacctacggagtgtcaagggttgaaggcgtggcagaggtc
aggggcgtgggggagatcgtgctcccgagggaggccggcgaggtggccgacgctttgagg
gccggcggggccagggtcagggtggtggaagacatagagcctgcgaggtggctgaagctg
gcgataaacgcggccataaaccccatcacagccctcctaagggccaagaacggagtcgtg
gtagagaacccgtatgccaagtcgctggccgccgaggcggctcgggaggcgggcagagtg
gcggaggccgtgggagtgcgcctgccggccgaccccgtggaagagacgctgagggtggcg
gaagccactagagacaacgtctcctcgatgttgcaagacttgtcccagtgtaggcggacc
gaagtggactacatcaatggggctgtcgtgaggctgggagagaggcatggcgtagaggcg
cccgtgaacaaggccctgtgggcccttgtgaaagccgcggaggcagcatgcggcgccgtg
taa

DBGET integrated database retrieval system