KEGG   Pyrobaculum calidifontis: Pcal_0664Help
Entry
Pcal_0664         CDS       T00483                                 

Definition
glyceraldehyde-3-phosphate ferredoxin oxidoreductase (EC:1.2.7.6)
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcal_0664
   01230 Biosynthesis of amino acids
    Pcal_0664
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_0664
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Pcal_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626105..627994
Genome map
AA seq 629 aa AA seqDB search
MNLLSSPRTGVILLEIDVEKREVAKREISATGPVDAALQLHRERETWRLDPLSPQIPVVF
GLGPFVGGRLYGVHRLIFVFKSPQSGTLHVSALGGAAYKAMGMGAQAVAIVGKAERPTAV
FIAGGQVSFTEVEVGKDAYSLIRRLYESNREFFVANDARALVVGPAAYTTYNGAIVSVDI
EAKSGEFKLGSEDFAARGGPGTALAQGHNVAAVVVGGPRRPLHEKVADAEAINQLFKQKM
GKSYVEVLNEKTVKYRYDPKIGTGGTFGVNYPHYRDLLPLFGYKSIYMPREERIKHADIV
LELFWRPFQREVFEKGKSWYNCGEPCPVVCKKVWRGKKVDYESFHAVGPFIGNYIFEEAV
PPVDKIDRLGLDAIEMGHVVAWLFDAVHHGLLKPEEVGIGERPAFDPLQFRPKEDSRLNA
KLAAELIDGLVEHATEVLALVAKLGIRRAARELERRYKDRVRETGVKFRDLAVYAAFGTE
GYMTPNFYWAPGLVAPMYILGRYWSNYNPTFMPPEDFAKSSYERAVAELYIDNAGICRFH
RGWAEPVLSDLYKLIGLTPPSPALYREFAYYAKLAGAEPMPWESKRARDLVSTLAKELGA
KDWQFTDFDDYYEWWTRFKEQLDRLVLST
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaatttattgagtagtccacggactggcgtgatactacttgagatagacgtggaaaag
agagaggtcgccaagagggagatatccgccaccggccccgtcgacgcggcgttgcagttg
cacagggaaagggagacgtggcgcctcgaccccctatctccacagatccccgtggtgttc
ggcctcggccccttcgtcggagggaggctgtacggagtccaccgcctaatcttcgtcttc
aaaagcccccagagcgggacactacacgtctccgcgctggggggagccgcctacaaggcc
atggggatgggcgcccaggccgtggccatcgtcggcaaggcggagaggccaacggcggtt
ttcatagccgggggacaagtatcttttacagaggtagaggtggggaaagacgcctactcc
ctcataaggcggctatacgagtccaacagagagttcttcgtggcaaacgacgccagggcg
ttggtagtcggcccagcggcgtacaccacctacaacggcgccattgtgtcggtggacata
gaggccaagagcggggagtttaagctgggctccgaggacttcgcggccaggggcgggccc
ggcaccgccctcgcacaggggcacaacgtggcggcagtggtagtgggcgggccccggagg
cccctccacgagaaagtcgcagacgcagaggccataaaccaactgtttaaacagaagatg
gggaagagctacgtcgaggttttaaacgagaagactgtgaaataccgctacgaccccaag
ataggcacaggcggcaccttcggcgtcaattacccccactaccgcgacttactgcccctc
ttcggctacaagtctatctacatgccgcgagaggagcggataaaacacgccgacattgtg
ctagagctgttctggcgccccttccagcgagaagtatttgaaaaggggaagagctggtac
aactgcggcgagccgtgccccgtggtgtgcaaaaaggtgtggcggggcaagaaggtggac
tacgagtccttccacgcggtgggccccttcatcgggaactacatattcgaggaggcggtg
ccccccgtcgacaagatagaccgcctcggcctagacgccatagagatgggacacgtcgtt
gcgtggctcttcgacgccgtacaccacggcttactcaagccggaggaagtggggatagga
gagaggccggccttcgaccccctacagtttaggccaaaggaggactcgaggctaaacgcc
aagctagccgccgagctcatagacggcctcgtggaacacgccacagaggtgctggcccta
gtggccaagcttgggataaggagagccgcgcgggagctggagaggagatacaaagacaga
gtgagagagacgggggtcaagttcagagacttagcagtgtacgcggcctttggcacagag
ggatacatgacgcccaacttctactgggccccaggcctagtggcgcccatgtacatccta
ggccgctactggtccaattacaaccccaccttcatgccacccgaggacttcgcaaaatcc
tcctacgagagggcagtcgccgagttgtacatagacaacgccggcatctgccgcttccac
agaggctgggcagagccagtcctctcagacctctacaagcttatcggcctaactccgccg
agccccgccttgtacagagaattcgcctactacgccaaattagccggcgcggagcccatg
ccctgggagagcaagagggccagggacctagtctcaacgctcgctaaggagctcggcgca
aaagactggcagttcacagattttgacgactactacgagtggtggacacggtttaaggaa
cagttggatcgacttgtactttcaacataa

DBGET integrated database retrieval system