KEGG   Pyrobaculum calidifontis: Pcal_0665Help
Entry
Pcal_0665         CDS       T00483                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, gamma subunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcal_0665
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_0665
   00020 Citrate cycle (TCA cycle)
    Pcal_0665
   00620 Pyruvate metabolism
    Pcal_0665
   00640 Propanoate metabolism
    Pcal_0665
   00650 Butanoate metabolism
    Pcal_0665
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pcal_0665
   00680 Methane metabolism
    Pcal_0665
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pcal_0665
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pcal_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
628060..628584
Genome map
AA seq 174 aa AA seqDB search
MLEMRFHGRGGQGMVTAAQVLATAAILEGKYAQAFPEFGPERRGAPVKAYLRIADTPIYV
REPILRPDVVVVADQSLFKAENPLEGAKETTVLVVNGVYKAPVKTYYVDATSLAMKILGR
PIVNTALIGAVVKATGVVLLGSVAKALAKFFSGKLYDLNLKLVEAAYQETREVP
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatgcgttttcacggccgcggcggacagggcatggtaacagcggcgcaagtg
ctcgccacggcggccatactcgagggcaagtacgcacaagccttccccgagtttggccca
gagaggcgtggcgcccccgtaaaggcctatctaaggatcgcggatacgcctatatacgta
agagagcccatactccgcccagacgtagtggtggtggcagaccagtcgctttttaaggcc
gagaaccccctagagggggcgaaggagaccacagtgctagtggtaaatggggtctacaag
gcccctgtaaagacttattacgtggacgcaacctctctagcaatgaagatcttgggcagg
ccaattgtgaacaccgccctaatcggcgccgtggtcaaggccaccggcgtagtgttgctg
ggatctgtggccaaggccttggcaaagttcttctctgggaagctctacgacctaaacctc
aaactcgtggaagcggcataccaagagactagagaggtgccatga

DBGET integrated database retrieval system