KEGG   Pyrobaculum calidifontis: Pcal_0666Help
Entry
Pcal_0666         CDS       T00483                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00010  Glycolysis / Gluconeogenesis
pcl00020  Citrate cycle (TCA cycle)
pcl00620  Pyruvate metabolism
pcl00633  Nitrotoluene degradation
pcl00640  Propanoate metabolism
pcl00650  Butanoate metabolism
pcl00680  Methane metabolism
pcl00720  Carbon fixation pathways in prokaryotes
pcl01100  Metabolic pathways
pcl01120  Microbial metabolism in diverse environments
pcl01130  Biosynthesis of antibiotics
pcl01200  Carbon metabolism
Module
pcl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
pcl_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_0666
   00020 Citrate cycle (TCA cycle)
    Pcal_0666
   00620 Pyruvate metabolism
    Pcal_0666
   00640 Propanoate metabolism
    Pcal_0666
   00650 Butanoate metabolism
    Pcal_0666
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pcal_0666
   00680 Methane metabolism
    Pcal_0666
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pcal_0666
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pcal_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_7 Fer4_10 Fer4_6 Fer4_9 Fer4_16 Fer4_2 Fer4_17 Fer4_8 Fer4_4 Fer4_13 Fer4_15 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ABO08092
JGI: pcal0666
UniProt: A3MTX5
Position
628581..628892
Genome map
AA seq 103 aa AA seqDB search
MSLPKASQLPIGTAITEPGSTRRNLTAGWRTLRPVIHDDRCIRCQLCWLYCPEGTIVEVK
GVFKVGNRTYDVKYEINYDYCKGCGICANECPTKAIEMVPETP
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgccaaaggcgtctcaactcccaatagggactgctattacagagccgggctcc
actaggcgcaatttgacagctggctggaggaccttgaggcctgtgatacacgacgacagg
tgcatacggtgccagctctgctggctctactgccccgagggcaccatagtcgaggtaaag
ggcgtcttcaaagtgggcaataggacctacgacgttaagtacgagatcaattacgactac
tgcaagggctgtggcatatgcgcaaacgagtgtccaacaaaggcaatagagatggtcccg
gagacgccatga

DBGET integrated database retrieval system