KEGG   Pyrobaculum calidifontis: Pcal_0667Help
Entry
Pcal_0667         CDS       T00483                                 

Definition
pyruvate ferredoxin oxidoreductase, alpha subunit (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcal_0667
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_0667
   00020 Citrate cycle (TCA cycle)
    Pcal_0667
   00620 Pyruvate metabolism
    Pcal_0667
   00640 Propanoate metabolism
    Pcal_0667
   00650 Butanoate metabolism
    Pcal_0667
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pcal_0667
   00680 Methane metabolism
    Pcal_0667
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pcal_0667
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pcal_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
628892..630070
Genome map
AA seq 392 aa AA seqDB search
MQVEKTKLREALTGNYAAAYAVKAVDVDVIAVYPITPQTTIVEKLSEFVANGELNAEIIH
VESEHSALSAVVGASAAGARVFTATSSQGLELAHEVLHIASGLRLPIVMAVPARAISAPI
SIHNDYGDVMNARDTGWVIYIAATAQEVYDTIIQAYRVAESVFLPVMVAYDGFLMSHTVE
PVELNDEDEVRKFVPRALRPYTLNPKRPVTLGALASPDWYYEFKYQQVEAMREAYKVAKD
VDAQYKAKFGRGYGVVETYRMEDADYAIVAYGGAAYGNARAAADLARERGIAAGVVRVRL
YRPFPTADVLRALSGVKAFAVVDRAIMFGSPAEGPLYKDIATAMYMHGVDKPAVNIIHGI
GQRAMYVEDFYKVYTMLREGPKREVVFMGVRV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtagagaagaccaagctcagggaggcgctgaccggcaactacgcggcggcgtac
gccgtcaaggcggtcgacgtggacgtaatcgccgtgtatcccattacgcctcagaccacc
atcgtggagaagctgtctgagtttgtggcaaacggcgagttgaacgcggagattatacac
gtggagtctgaacacagcgcactttccgccgtcgtgggcgcctcggcggcgggggcgaga
gtcttcacggccacctctagccaggggctggagctggcccacgaggtgttgcacatagcg
agtgggcttaggttgccaatcgtcatggcggtgccggctagggccatctcggcgcctatc
agcatccacaacgactacggcgacgtgatgaacgcccgcgacacggggtgggtgatctac
atcgccgccacggcgcaggaggtctacgacacgataatacaggcgtatagagtggcagag
tctgtcttcctccccgtcatggtggcatacgacggcttcctcatgagccatacggtggag
ccagttgagctaaacgacgaggacgaggtgaggaagttcgtgccgcgcgcccttaggccc
tacactctaaaccccaagaggcctgtgactctaggcgcgttggcctccccagactggtac
tacgagtttaagtaccagcaagtggaggcgatgcgggaggcgtacaaagtggccaaggac
gtggacgcccagtacaaggccaagttcggccgcggctacggagtcgtggagacgtacaga
atggaagacgcagattacgcaatagtggcctacgggggggccgcctacggcaacgccagg
gcggccgcagatttggcgagggagaggggcatagccgccggcgtagtccgcgtaaggctc
taccgccccttccccaccgcggacgtgctgagggccttaagcggcgtgaaggcgtttgca
gttgtggacagggcgattatgtttgggagccccgccgaggggcctctctacaaggatata
gccacggctatgtatatgcacggcgtagataagccggctgtgaatataatccacggcata
ggtcaaagggctatgtatgtagaagacttctacaaggtgtacacaatgttgagagagggc
cccaagagggaagtggtattcatgggggtgagggtatga

DBGET integrated database retrieval system