KEGG   Pyrobaculum calidifontis: Pcal_0817Help
Entry
Pcal_0817         CDS       T00483                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00010  Glycolysis / Gluconeogenesis
pcl00051  Fructose and mannose metabolism
pcl00562  Inositol phosphate metabolism
pcl01100  Metabolic pathways
pcl01110  Biosynthesis of secondary metabolites
pcl01120  Microbial metabolism in diverse environments
pcl01130  Biosynthesis of antibiotics
pcl01200  Carbon metabolism
pcl01230  Biosynthesis of amino acids
Module
pcl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_0817
   00051 Fructose and mannose metabolism
    Pcal_0817
   00562 Inositol phosphate metabolism
    Pcal_0817
Enzymes [BR:pcl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pcal_0817
Exosome [BR:pcl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pcal_0817
  Exosomal proteins of bladder cancer cells
   Pcal_0817
  Exosomal proteins of melanoma cells
   Pcal_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG His_biosynth NMO IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABO08243
JGI: pcal0817
UniProt: A3MUC6
Position
779910..780596
Genome map
AA seq 228 aa AA seqDB search
MRLPILIINFKAYREAAGKRAVELAKAAEKVAKELGVSIAVAPNHLELALVAASVDIPVY
AQGVDVEKAGAYTAHVALENLREAGAVGVILNHSEAPLKLNDLAKYVEGGKAMGLDVVVC
APDPLTSLAAAALGPHAVAVEPPELIGTGRAVSKYKPETVVKTVELVSAHFPNVAVITGA
GIESGEDVEAALRLGTRGVLLASAAVKAKDPYQKIMELAKPLVAAGPP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaggttaccaattcttatcataaactttaaggcgtatcgcgaggcggctgggaagagg
gctgtggagcttgccaaggccgcggagaaggtggctaaggaacttggcgtcagtatagcg
gtagcgcccaaccacctcgagctggcccttgtagcggcgtcggtagacatccccgtgtat
gcccagggagtcgacgtagagaaggctggggcctacacagcgcatgtggctcttgagaac
ttgagggaggcgggggcggtgggggttatcttgaaccacagcgaggcacccctcaagctc
aacgatttggctaagtacgtggagggcggaaaggcgatgggcttagacgtcgttgtctgt
gcgccagaccctctgacctcgctggcggccgcggcgttggggcctcacgccgtcgccgta
gagccgccggagctcattggcacaggccgcgccgtgtctaagtacaagccagagactgtg
gtaaagacggttgagctcgtctctgcccacttccccaatgtggccgtgataactggcgcg
gggattgaaagtggagaagacgtggaggccgcgctcaggcttgggacaaggggggtcctt
ctcgcaagcgccgcggtcaaggctaaagacccctatcagaagattatggagctggcaaag
cccttggtcgcggcagggccgccttag

DBGET integrated database retrieval system