KEGG   Pyrobaculum calidifontis: Pcal_0842Help
Entry
Pcal_0842         CDS       T00483                                 

Definition
Cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pcal_0842
Enzymes [BR:pcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pcal_0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
803372..804460
Genome map
AA seq 362 aa AA seqDB search
MDDFFELLKKLAEARGPSGFEDEVRELVAREMEPFVDEVVVDRWGNVIGVKRGSTNYRAM
VAAHIDEIGLVVDHIEKEGFLRVRGIGGWNEVTLVGQRVWVRTRDGKWIRGVVGVTPPHI
TPSGKEREAPEMKDLFIDIGARDREEAEKLGVTIGSVAVLDRDVVKLQNDVVAGKAFDDR
VGVAVMLYALRMLKETPTTVYTVATVQEEVGLRGAQIAAEKVSPHYAIALDTTIAADVPG
VPERQHIVKVGKGPAIKVIDGGRGGLFIAHPPLRNHIIKVAEELGIPFQLEVLYGGTTDA
MAIAFRREGVPTAAISVPTRYVHSPVEVLSLSDAVNAARLLAAVLEKTKPNIIEMFLDKK
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacgacttctttgaactgctgaaaaaattggcggaggctaggggcccctcgggcttt
gaggacgaggtgagggaactcgtggcaagggaaatggagccgtttgtcgacgaagtcgtg
gtagaccggtggggcaacgtaatcggcgtcaagaggggctccaccaactacagggccatg
gtggccgcccacatagacgaaattgggctagtggtagaccacatagagaaggagggcttt
ctccgcgtgagaggcatcggcgggtggaacgaggtcaccctagtgggccagagagtgtgg
gtgaggactagagacggcaagtggatacgcggcgtcgtcggcgtcactcctccgcacatt
acgccgtctggcaaagagcgcgaggcccccgagatgaaggacttgttcatagatataggg
gccagagacagagaagaggcagagaagctgggggtcaccataggctctgtcgccgtgtta
gacagagacgtggtcaagcttcagaacgacgttgtggctggcaaggcgtttgacgacaga
gtcggcgtcgccgtcatgttgtacgcgctgaggatgctcaaggagactcccacgactgta
tacaccgtggccactgtgcaagaggaggtggggctgaggggcgcgcagatagcggcggag
aaggtgtccccccactacgccattgctctcgataccaccattgcagcagatgtgccaggg
gtgccagagcggcaacacatagtaaaagtggggaaggggcccgcgattaaggtcatcgac
ggcggcagaggagggctgttcatagcccacccgcctctgcgcaaccacattatcaaagtt
gcagaggagctgggcatccccttccaactggaagtcctctacggcggaaccacagacgcc
atggctatagcgtttaggcgagagggcgtgcccactgcggcaatctccgtgccaacgcgc
tacgtccactcccccgtggaggttctgagcctcagcgacgccgtgaatgcagcgcggcta
ttagccgccgtgttagaaaaaactaagcctaatattatagagatgttccttgataagaaa
atcaagtaa

DBGET integrated database retrieval system