KEGG   Pyrobaculum calidifontis: Pcal_0842Help
Entry
Pcal_0842         CDS       T00483                                 

Definition
(GenBank) Cellulase
Organism
pcl  Pyrobaculum calidifontis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
803372..804460
Genome map
AA seq 362 aa AA seqDB search
MDDFFELLKKLAEARGPSGFEDEVRELVAREMEPFVDEVVVDRWGNVIGVKRGSTNYRAM
VAAHIDEIGLVVDHIEKEGFLRVRGIGGWNEVTLVGQRVWVRTRDGKWIRGVVGVTPPHI
TPSGKEREAPEMKDLFIDIGARDREEAEKLGVTIGSVAVLDRDVVKLQNDVVAGKAFDDR
VGVAVMLYALRMLKETPTTVYTVATVQEEVGLRGAQIAAEKVSPHYAIALDTTIAADVPG
VPERQHIVKVGKGPAIKVIDGGRGGLFIAHPPLRNHIIKVAEELGIPFQLEVLYGGTTDA
MAIAFRREGVPTAAISVPTRYVHSPVEVLSLSDAVNAARLLAAVLEKTKPNIIEMFLDKK
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacgacttctttgaactgctgaaaaaattggcggaggctaggggcccctcgggcttt
gaggacgaggtgagggaactcgtggcaagggaaatggagccgtttgtcgacgaagtcgtg
gtagaccggtggggcaacgtaatcggcgtcaagaggggctccaccaactacagggccatg
gtggccgcccacatagacgaaattgggctagtggtagaccacatagagaaggagggcttt
ctccgcgtgagaggcatcggcgggtggaacgaggtcaccctagtgggccagagagtgtgg
gtgaggactagagacggcaagtggatacgcggcgtcgtcggcgtcactcctccgcacatt
acgccgtctggcaaagagcgcgaggcccccgagatgaaggacttgttcatagatataggg
gccagagacagagaagaggcagagaagctgggggtcaccataggctctgtcgccgtgtta
gacagagacgtggtcaagcttcagaacgacgttgtggctggcaaggcgtttgacgacaga
gtcggcgtcgccgtcatgttgtacgcgctgaggatgctcaaggagactcccacgactgta
tacaccgtggccactgtgcaagaggaggtggggctgaggggcgcgcagatagcggcggag
aaggtgtccccccactacgccattgctctcgataccaccattgcagcagatgtgccaggg
gtgccagagcggcaacacatagtaaaagtggggaaggggcccgcgattaaggtcatcgac
ggcggcagaggagggctgttcatagcccacccgcctctgcgcaaccacattatcaaagtt
gcagaggagctgggcatccccttccaactggaagtcctctacggcggaaccacagacgcc
atggctatagcgtttaggcgagagggcgtgcccactgcggcaatctccgtgccaacgcgc
tacgtccactcccccgtggaggttctgagcctcagcgacgccgtgaatgcagcgcggcta
ttagccgccgtgttagaaaaaactaagcctaatattatagagatgttccttgataagaaa
atcaagtaa

DBGET integrated database retrieval system