KEGG   Pyrobaculum calidifontis: Pcal_1032Help
Entry
Pcal_1032         CDS       T00483                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00010  Glycolysis / Gluconeogenesis
pcl00052  Galactose metabolism
pcl00500  Starch and sucrose metabolism
pcl00520  Amino sugar and nucleotide sugar metabolism
pcl00521  Streptomycin biosynthesis
pcl01100  Metabolic pathways
pcl01110  Biosynthesis of secondary metabolites
pcl01120  Microbial metabolism in diverse environments
pcl01130  Biosynthesis of antibiotics
pcl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_1032
   00052 Galactose metabolism
    Pcal_1032
   00500 Starch and sucrose metabolism
    Pcal_1032
   00520 Amino sugar and nucleotide sugar metabolism
    Pcal_1032
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pcal_1032
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pcal_1032
Enzymes [BR:pcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pcal_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N MutL
Motif
Other DBs
NCBI-ProteinID: ABO08457
JGI: pcal1032
UniProt: A3MUZ0
Position
968479..969369
Genome map
AA seq 296 aa AA seqDB search
MAKYLGIDVGATWTRAILVDEGGSVLSRAKIRTGVSPVAEIAEVVAGWDFDAVGVGSIGP
MDLKTGVVVNSPNSPSRRFPLVEPLKKFKRPVVVANDCVAAVWGEYVFKYHVDNMAYLTL
STGVGVGAIVNGVLLLGKDGNAHELGHAVIDFKSPRRCGCGGLGHFEAFVGGANMPSFYQ
EVAGEGPLLPEEIFKRAREGYRKAVEFLDVWLDALAAGVATILAAYDPELLIVGGSIALN
NWDIVGRELPKRLVKYLGVRGAEIRPASFGDDEVAIGAAALAYKTPETLKKFGYPR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagtacttggggatagatgtgggggcgacgtggactagggccattttagttgat
gagggcggctccgttctgtcaagggcgaagattaggactggcgtgagccccgttgctgaa
atcgccgaggttgtcgctggttgggatttcgacgcggtgggggtggggtccattggccca
atggatctcaaaacgggggtggtcgtaaattctccgaactctccctctaggcggtttcca
cttgtggagcctctgaagaagttcaaaaggcctgtggtagttgctaacgactgcgtggcg
gcggtgtggggcgagtacgtgtttaaataccacgtggacaacatggcgtacttgactttg
tccactggcgttggggttggggcaattgtaaacggagtcttgctgttgggcaaagacggc
aacgcccacgagctcggccacgccgtgatagacttcaagtcgcctaggcggtgcggttgc
ggcggcctcggccattttgaggccttcgtcggcggcgccaacatgcccagcttctaccaa
gaggtcgccggggaagggcccctcctgcctgaggagatatttaagcgggctagagagggc
taccgcaaggcagtggagttcttagacgtgtggttggacgcacttgcggcgggggtagcc
accatccttgcagcatatgacccagagcttttgatagtggggggatctatagccttgaac
aactgggacattgtgggccgggagttgcccaagaggcttgtaaaatacctgggcgtaaga
ggggcggagattaggccggcgtcttttggtgacgacgaggtggccatcggggccgccgct
ctggcgtataagacgcctgagacattgaagaagtttgggtatccccgatag

DBGET integrated database retrieval system