KEGG   Pyrobaculum calidifontis: Pcal_1072Help
Entry
Pcal_1072         CDS       T00483                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Pcal_1072
Enzymes [BR:pcl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Pcal_1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1010458..1011027)
Genome map
AA seq 189 aa AA seqDB search
MEEEFLRYVRLLYERGHITLLSGNVSAKSGDLILITPTNWPKPFLTPEDLVWINLSGEVV
KGRLRPTSEWRLHVEVYKRRQDVGAVVHTHDVLPTVLAERIDASALSEAEAYLGSGVAVV
PYIKPGTRELAEAAAEALIHSNVAVLKRHGVVAVGRDLAEAVNRVEVLADLAKATLYTTI
LKIVEKYAL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagtttctacggtacgtaaggctgttgtacgagagggggcacataacgctt
ttgtctggcaacgtctcggccaagagcggggacttaatcctcattacgccgacgaattgg
ccgaagcccttcttgacgcccgaggacttggtgtggataaacctctccggcgaagtggtg
aagggtaggctgaggccgactagcgagtggaggctccacgtggaggtgtacaagaggcgg
caggacgtgggggctgtggttcatacgcacgacgtgttgcccactgtgttggccgagagg
atagacgcctctgccttgtcggaggccgaggcctatctgggctctggcgtggctgttgtg
ccgtatataaagccgggcacgagggagctcgcggaggcggcggccgaggcgcttatccac
agcaacgtggctgtgttgaagagacacggcgtggtggccgtggggagagacttggccgag
gctgtgaatagggtagaggtgttggcagacttagctaaggcgacgttgtacacgactatt
ttaaaaatagtggagaagtatgcgctgtga

DBGET integrated database retrieval system