KEGG   Pyrobaculum calidifontis: Pcal_1162Help
Entry
Pcal_1162         CDS       T00483                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00790  Folate biosynthesis
pcl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pcal_1162
Enzymes [BR:pcl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Pcal_1162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABO08587
JGI: pcal1162
UniProt: A3MVC0
Position
1085150..1086052
Genome map
AA seq 300 aa AA seqDB search
MEIRGVLGRVEVGDGLPVRIMAVLNLSPESFYKGSVAVENAVERALGLEKYADIIDVGAM
STAPYLETWIPPEKELERLKAVLPDIVKSVKATVSVDTYRPEVARYALKVGAEVINDVTG
GKLYPDMCRVVAEHDASVVLLAREREARRGVAPIQRVLDALRESVEHFQRCGVDPRKIAV
DPGVGFPLLPPRDEPYVVKGEYRHGDEKWPWWKWDLHILANLRELRRLGKPILIGVSRKS
FLRRIVGAESPDEVLPASLAAEAVAVLHGAHVVRTHNPKETRQAAAFAKALVDLFQKLDH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaggggggttctggggagagtagaggtgggggacgggctccccgtgaggata
atggccgtgttaaacctgtcccccgagtcgttttacaaggggtcagtggctgtggaaaac
gccgtggagagggcgctggggctcgagaagtatgccgacattatagacgtaggcgccatg
tccacagccccctacctagagacctggataccgccggagaaggagctggagaggctaaag
gcagtgctccccgacattgtaaaatctgtaaaagccacagtgagcgtggacacctacagg
ccagaggtggcgcgctacgcgcttaaggtcggcgcagaggtgataaacgacgtcacaggc
ggcaagctgtacccggacatgtgccgcgtcgtcgccgagcacgacgcctcagtggtgttg
ttggccagggagagggaggcgaggaggggcgtggcccccatccagagggttttagacgca
cttagagagtcggtggagcacttccagcgctgtggagtagaccccaggaagatagcggtg
gaccccggcgtgggcttccccctactgcccccgagagacgagccctacgtggtaaaaggc
gagtataggcacggggacgagaagtggccctggtggaagtgggacctccacatactcgcc
aacttgagagagctgaggaggctcggcaagcccatcctaataggcgtgtcgcgtaagtct
ttcctaaggcgaatcgtcggcgcggagagccccgacgaagtgctcccagcctcgctggct
gcagaggccgtcgcagtgctacacggggcacacgtggtgaggacacacaacccgaaggag
actaggcaggctgccgctttcgcaaaggcgctagtagaccttttccaaaaacttgaccac
tag

DBGET integrated database retrieval system