KEGG   Pyrobaculum calidifontis: Pcal_1206Help
Entry
Pcal_1206         CDS       T00483                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pcal_1206
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcal_1206
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcal_1206
Enzymes [BR:pcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pcal_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1118241..1119482
Genome map
AA seq 413 aa AA seqDB search
MDRWYNIAADLPAPLAPPRDPDEGESRIALLTRILPSALIDQEFTAERWVAIPEEVRAVY
ARLGRPTPLLRAEGLERALGVEVRIYYKYEGVLPVGSHKVNTAVAQAYYAKADGAVEVAT
ETGAGQWGMAVSLAAALFGLRAVVFMTRSSYNSKRQRLAFMRAYGATVYPSPSDVTEAGR
RHYRPDHPGSLGIAISEAVEYVLSGERRRYLPGSVMEFVLLHQTVIGLEAVRQLPEEPDV
AVACVGGGSNFAGFTYPMIGAKLRGEGFEKTRFIAAESAAAPKLTKGEYRYDFPDAVGTL
PMIKMYTLGHDYVPPPVHAAGLRYHGAAPSLSLLRRLGYIEAVAYPQEEVMQAALLFART
EGVIPAPESAHAIKAAIDIAKKLPPGSVIAINVSGHGLLDVDAYEKFLDIKQP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtggataggtggtacaacatagcggctgacttgccggcgcctttggcgcctcccagggac
ccggacgagggggagagcaggattgccctcttgacgaggattctcccatcggcgcttatc
gaccaggagttcaccgcagagaggtgggtcgccatcccggaggaagttagggcggtctac
gccaggctgggaaggcccactcccctcctccgtgccgagggtctggagagggcccttggg
gtcgaggtgaggatttactacaagtacgagggcgttctgccggtgggtagccataaggtc
aacacggcggtggcccaggcctactacgccaaggctgacggcgcggtggaagtggccacg
gagactggggcggggcagtggggcatggcggtctcgctagccgcggccctctttggcctc
agggcggtggtgtttatgactaggtcttcttacaactccaagcggcagaggctcgccttt
atgagggcctacggcgccactgtgtaccccagcccaagcgacgtcactgaggcggggagg
aggcactacaggccggaccaccccggctcccttggcatagccatatcggaagctgtggag
tacgtcctctcgggggagaggaggcgctacctgccgggcagcgtgatggagttcgtcctc
ttgcaccagacggtgattgggctagaggccgtgaggcagttgcccgaggagcccgacgtc
gccgtggcctgcgtgggtggggggtccaacttcgccggctttacctacccaatgataggg
gccaagctgaggggggaggggtttgagaaaacccgcttcatagccgcagagtccgccgcc
gcccccaagttgaccaagggagagtacagatacgacttccccgacgcggtgggcaccttg
cccatgatcaagatgtacaccctgggccacgactacgtcccgccccccgtccacgccgcg
gggctccgctaccacggagcggcgccgagcctatccctcctacgccgcctcggctacata
gaggcagtggcctacccccaggaggaggttatgcaagccgccctactattcgcccgaaca
gagggcgtaatcccagcccccgagtcggcccacgccataaaagccgcaatagacatagcc
aagaagttgcccccaggctccgtcatcgccataaacgtctccggccacggcctcctagac
gtagacgcctacgaaaaattcctagacataaaacagccctag

DBGET integrated database retrieval system