KEGG   Pyrobaculum calidifontis: Pcal_1211Help
Entry
Pcal_1211         CDS       T00483                                 

Definition
tryptophan synthase, alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pcl00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pcl00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1122713..1123435
Genome map
AA seq 240 aa AA seqDB search
MSGHMIKRPALGVYIVAGWPSAEVYREAVARLSGLVDFFELGVPTKNPKYDGPYIRAAHR
EVAAPVWDKPAAPTYLMAYWEDYAARPAELFNLAAEVGARGVLAPDLLVDYPGDLEQYLA
LSKEFGLAPVFFLPSKFPHSLARRIAAAGPDFIYLGLYAATGIELPVYVERNISIVKGLA
PEVPLVAGFAIDRPEKAVKAVKAGADGVVVGTAFMRRLKSSVEEGLRFLWEIKQALVGLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggcacatgattaagcgacccgccctaggcgtgtacattgtggctggttggccc
agcgccgaggtatacagggaggccgtggccagactctccggcctcgtggacttcttcgag
ctgggcgtccccacgaagaatcccaagtacgacgggccctacatccgcgcggctcataga
gaagtcgcagcgccggtttgggacaagcctgcggcgccgacttacttgatggcgtattgg
gaggactacgcggcgcggcccgcggagttgttcaacctggcggccgaggtcggcgcgcgg
ggggtcctggcgccggacctcctcgtggactacccgggggacttggagcagtacttggcc
ttgtccaaggagtttggcctagcccccgtcttcttcctcccctcgaagttcccgcacagc
ctcgccaggcggatcgcagcggcggggccggacttcatatacctcggactctacgcggcc
acggggatagagctccccgtctacgtggagcgcaacatctccatcgtcaaggggctggcg
cctgaggtccccctcgtggctggctttgcaatagacaggccggagaaggctgtcaaggcg
gtgaaggcgggggcagacggcgtcgtggttggcacggcgtttatgaggaggctgaaaagc
tccgtggaggaggggctccgcttcctgtgggagattaagcaggcgcttgttgggctacga
tag

DBGET integrated database retrieval system