KEGG   Pyrobaculum calidifontis: Pcal_1211Help
Entry
Pcal_1211         CDS       T00483                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00260  Glycine, serine and threonine metabolism
pcl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pcl01100  Metabolic pathways
pcl01110  Biosynthesis of secondary metabolites
pcl01130  Biosynthesis of antibiotics
pcl01230  Biosynthesis of amino acids
Module
pcl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcal_1211
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcal_1211
Enzymes [BR:pcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pcal_1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NanE ThiG PcrB His_biosynth FMN_dh IGPS PA
Motif
Other DBs
NCBI-ProteinID: ABO08636
JGI: pcal1211
UniProt: A3MVG9
Position
1122713..1123435
Genome map
AA seq 240 aa AA seqDB search
MSGHMIKRPALGVYIVAGWPSAEVYREAVARLSGLVDFFELGVPTKNPKYDGPYIRAAHR
EVAAPVWDKPAAPTYLMAYWEDYAARPAELFNLAAEVGARGVLAPDLLVDYPGDLEQYLA
LSKEFGLAPVFFLPSKFPHSLARRIAAAGPDFIYLGLYAATGIELPVYVERNISIVKGLA
PEVPLVAGFAIDRPEKAVKAVKAGADGVVVGTAFMRRLKSSVEEGLRFLWEIKQALVGLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggcacatgattaagcgacccgccctaggcgtgtacattgtggctggttggccc
agcgccgaggtatacagggaggccgtggccagactctccggcctcgtggacttcttcgag
ctgggcgtccccacgaagaatcccaagtacgacgggccctacatccgcgcggctcataga
gaagtcgcagcgccggtttgggacaagcctgcggcgccgacttacttgatggcgtattgg
gaggactacgcggcgcggcccgcggagttgttcaacctggcggccgaggtcggcgcgcgg
ggggtcctggcgccggacctcctcgtggactacccgggggacttggagcagtacttggcc
ttgtccaaggagtttggcctagcccccgtcttcttcctcccctcgaagttcccgcacagc
ctcgccaggcggatcgcagcggcggggccggacttcatatacctcggactctacgcggcc
acggggatagagctccccgtctacgtggagcgcaacatctccatcgtcaaggggctggcg
cctgaggtccccctcgtggctggctttgcaatagacaggccggagaaggctgtcaaggcg
gtgaaggcgggggcagacggcgtcgtggttggcacggcgtttatgaggaggctgaaaagc
tccgtggaggaggggctccgcttcctgtgggagattaagcaggcgcttgttgggctacga
tag

DBGET integrated database retrieval system