KEGG   Pyrobaculum calidifontis: Pcal_1213Help
Entry
Pcal_1213         CDS       T00483                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pcal_1213
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcal_1213
Enzymes [BR:pcl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pcal_1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1124137..1124889
Genome map
AA seq 250 aa AA seqDB search
MDFLAAVKRAVELRLATEPPPPPRTAPLVDFAKGLGEFGIIAEYKRASPRGVVRLDLPPW
AYFAEVYPHVSAFSVLTEPFWFLGDYRFLPLAKAFKPVLMKDFIIDKRQIDAAYGYGADA
VLIIYKLVGREKAMELAEYAQRLGLTPVVEVDNVQDAKEVATWGGRVVLGINARDLRTLE
VSLSRAFEVAKALRGDVDYIIESGISKPEEVERACEVYARGVLVGTALMKNPQLAKELAH
AAHRACKARS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggacttcctggccgcggtcaagcgggctgttgagctcaggctggccacggagcccccg
ccgcctccccgcacggcgccgctggtggacttcgccaaggggctcggggagtttgggata
attgccgagtacaagcgcgcctcgccgcggggcgtagtaaggctggacctacccccctgg
gcctacttcgccgaggtatacccccacgtctccgctttctcagtactgacagagcccttc
tggttcctaggcgactaccgcttcctgcccctggccaaggcctttaagcccgtcttaatg
aaggactttataatagacaagaggcagatagacgccgcctacggctacggcgcagacgcc
gtgctcataatatacaagctcgtggggagggagaaggcgatggagttggccgagtacgcc
cagcgcctaggcctaaccccagtggtggaggtggacaacgtccaagacgccaaggaggtg
gccacctggggcgggagagtggtgttggggataaacgcgagagacctgcgaactctcgag
gtgagcctctccagggcctttgaggtggccaaggcgctgaggggggacgtggattacata
attgaaagcggcatctccaagccggaggaggtggagagggcctgcgaggtctacgcaaga
ggcgtgttggttgggacggccctgatgaaaaacccgcagttggccaaggagcttgcccac
gccgcacatcgggcttgtaaggctcgttcataa

DBGET integrated database retrieval system