KEGG   Pyrobaculum calidifontis: Pcal_1311Help
Entry
Pcal_1311         CDS       T00483                                 

Definition
Alcohol dehydrogenase GroES domain protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pcal_1311
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_1311
  Lipid metabolism
   00071 Fatty acid degradation
    Pcal_1311
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pcal_1311
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pcal_1311
   00626 Naphthalene degradation
    Pcal_1311
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pcal_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227865..1228911
Genome map
AA seq 348 aa AA seqDB search
MRAAVIKEWGTPLEVTDVPKPEPGPGEVLVRISASGVCHTDIHQWKGDWPPVQALMIQHG
VRILGHEGIGVVEEVGLGVSTLKKGDRVGVPWMNYWCGRCEYCLSGYPHWCPHAKYTSVH
VDGTHAEYAIISERATPRIPKEISDVEAAPLMCAGVTAYGAVRKLITEAAIPPGKPIAII
GAAGGLGHYAVQIAKAFGYTVVGIDVGAERVKFVEKLGADYAVDVGEADKFVMDKWGGVY
ASVVFTPRLEGYRLGLRLLRPLGALVFVGLPDMKEGGLELYPLVVVGRGIRIFGSSVGVT
HEFEELFNLVVQGKVKSHVTKTASLSEINEVFKDLEEGKIVGRAVLKI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgagggcggcggtgatcaaggagtggggcacgccgctggaagtaaccgacgtgcccaag
cccgagcctggaccaggcgaggtcttagtccgcatatctgcctcaggggtgtgtcacaca
gacatccaccagtggaagggagactggcccccggtacaagccctgatgattcaacacggc
gtgcggatcctcggccacgaggggattggggtggtagaggaggtcgggcttggggtctct
accctcaagaagggggacagagtgggagtcccctggatgaactactggtgcggccggtgt
gagtactgcctctctggctacccccactggtgcccccacgccaagtacacctctgtccac
gtggatgggacacacgccgagtatgctattattagcgaacgcgcgactcctcgtataccc
aaggagattagcgacgtcgaagccgcgccgcttatgtgcgccggggtgacggcctacggc
gcggtgaggaagttgatcaccgaggcggcgataccgccagggaagcccatagcgattata
ggcgctgccggcggcctaggccactacgccgtgcaaatcgccaaggcttttgggtacacg
gtggttggaatagacgtgggagcggagagagtgaagttcgtggagaagctcggcgccgat
tatgcagtagacgtgggagaggctgataagtttgtaatggacaagtggggcggagtttat
gcctcagttgtctttacgcccaggctagagggctataggctggggctgaggcttttgagg
cctcttggggccttggtgttcgtgggcctcccagacatgaaagagggcggccttgagctc
taccccctcgtagtcgtggggcgcggcattaggatatttgggagttcggtcggcgtaacc
cacgagtttgaagaattgtttaacctagtggtgcaggggaaagtgaagagccacgttaca
aagacggcctctctaagcgaaataaatgaagtattcaaagacttagaggagggaaagatc
gtggggagggcagtcttaaaaatctaa

DBGET integrated database retrieval system