KEGG   Pyrobaculum calidifontis: Pcal_1403Help
Entry
Pcal_1403         CDS       T00483                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00010  Glycolysis / Gluconeogenesis
pcl00020  Citrate cycle (TCA cycle)
pcl00620  Pyruvate metabolism
pcl01100  Metabolic pathways
pcl01110  Biosynthesis of secondary metabolites
pcl01120  Microbial metabolism in diverse environments
pcl01130  Biosynthesis of antibiotics
pcl01200  Carbon metabolism
Module
pcl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_1403
   00020 Citrate cycle (TCA cycle)
    Pcal_1403
   00620 Pyruvate metabolism
    Pcal_1403
Enzymes [BR:pcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pcal_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABO08823
JGI: pcal1403
UniProt: A3MW06
Position
complement(1316603..1317778)
Genome map
AA seq 391 aa AA seqDB search
MIEFKFPDLGEGLVEGEVVKWHKREGDFVKEGEDLVDVMTEKATVTLPSPATGRIVKILA
KEGGVVKVGQVLCIIEEAAPGAPVEAKAEARPEVRAMPAARRLAKELGLDLSKVVGTGPG
GVITVEDVRRAAEAAKREVGVAEAKPAAPAPPAEERPAQPLREERIPVRGVRRAVAEKMK
KSKSQIPHAYHVDEVDVTELVKLRERLKAYAGDVRLTYTPFFVKAAVAALKKYPLLNASF
DEERGEIVVKKYFNIGVAVDTENGLVVVVIKDADSKSILEVARELQEKSARAREGKLSLD
DVRDSTFTITNIGAIGGLWGLAVVNYPETAILATGRIVKRPRVYEGQVVPRDVMYVAVSF
DHRVVDGGYVARFTNAFKELLESPDLLVLNL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgattgagttcaagttccccgacttgggcgaggggctggtggagggggaggtggtgaag
tggcacaagcgggagggcgacttcgtcaaagagggggaggacctcgtggacgtcatgact
gagaaggccactgtgactctgccctcccccgccacggggaggattgtgaaaatcttggcc
aaggaggggggggtggtgaaggtgggccaggtcttgtgcataattgaggaggcggccccc
ggcgcccccgttgaggctaaggccgaggcgcggccagaggttagggctatgcccgccgcg
aggcggttggccaaggagcttgggttggacttgtccaaagtggtgggaactgggccgggc
ggggttatcactgtggaggacgtgaggagggccgcggaggcggcgaagcgggaggtcggc
gttgcggaggcgaagcccgctgcgcctgcgccgccggctgaggagaggcctgcccagcct
ctgcgggaggagaggatccccgtgaggggtgtcaggagggccgtggccgagaagatgaag
aagtccaagtctcagataccccacgcctaccacgtggacgaggtggatgtgacagagttg
gtcaagctgagggagaggctcaaggcctacgctggggatgtgaggctcacctacacgcct
ttctttgtgaaagccgccgtggccgccttgaagaagtaccccctcctcaacgcgtctttc
gacgaagagcggggcgagatagtggtgaagaagtacttcaacataggcgtcgccgtggac
acagagaacgggctcgtcgtggttgtgatcaaagacgcagactctaagtccatactggag
gtggcaagggagctccaggagaagagcgcgcgggccagggaggggaagctctcccttgac
gacgtgagggactccacctttaccataaccaacataggcgccatcggcgggctctggggc
ctggcagtggtgaactaccccgagaccgccatattggccacggggagaattgtgaaaagg
cccagggtgtacgaggggcaggtggtgcccagggacgtgatgtacgtggcggtgagcttc
gaccacagggtggtcgacgggggctacgtggccaggttcaccaacgcgtttaaggagctc
ctcgagtcccccgacctcctggtgctaaacctatga

DBGET integrated database retrieval system