KEGG   Pyrobaculum calidifontis: Pcal_1458Help
Entry
Pcal_1458         CDS       T00483                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00860  Porphyrin and chlorophyll metabolism
pcl01100  Metabolic pathways
pcl01110  Biosynthesis of secondary metabolites
pcl01120  Microbial metabolism in diverse environments
Module
pcl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pcal_1458
Enzymes [BR:pcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pcal_1458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Peripla_BP_6 TPR_MLP1_2
Motif
Other DBs
NCBI-ProteinID: ABO08878
JGI: pcal1458
UniProt: A3MW61
Position
1360737..1361546
Genome map
AA seq 269 aa AA seqDB search
MPTVVITSGRAHKADLLAKMLTRAGIEPVYLPVVKIGEAGGADVAKFIDEISHFDVFIFM
TGQSVASLVQEAKRAGLEQRLREALSRMTILCRGSKAAGNVKSLLGLTCAVVEETSEELL
KVAERTLEGKRVAISFYGYLDDEFLREVQKRAAEVKYIQTYRTELEENAAEIAKLVLAGE
ADVVVFTSALACNSFFTQLSALGLAEKVANRFRSGAVKLAAVGPVTAEECKKFGVEPHIV
PEKPFLAYLGEAIIRHLKPTLNTDSVRTQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcccactgtggtaataacctcggggagggcacacaaggcggacctcctggccaagatg
ttgaccagggcaggcatagagcctgtctacctccccgtggtaaagataggagaggccggg
ggtgcggacgtggcgaagttcatcgacgagatatcccacttcgacgtcttcatattcatg
actgggcagtcggttgcaagcttagtgcaagaggctaagagggctgggctagagcagagg
cttagggaggccctctccaggatgactattctgtgtaggggcagcaaggccgctggcaac
gtgaaatctctcctaggcctcacctgcgccgtggtggaggagacctcggaggagctgttg
aaggttgctgagagaacgcttgaggggaagagggtggccatatcgttctacgggtaccta
gacgacgagtttctgcgggaggtgcagaagagggccgcagaggtgaagtacatacagacc
tacaggacagagcttgaggaaaatgcggcagagatagcgaagctggtcttggcgggggag
gcagacgtggtggtcttcacaagcgctctggcctgcaacagctttttcacacagctcagc
gccctaggcctagccgaaaaagtggccaaccggtttaggtcgggcgccgttaagctggcg
gcggtggggccagtcacggcagaagagtgcaaaaaatttggcgtagagccgcacattgtg
ccagaaaagcccttcttggcgtatctcggcgaggccatcataaggcacttaaaaccaacg
ctgaacaccgacagcgtgaggacacaatag

DBGET integrated database retrieval system