KEGG   Pyrobaculum calidifontis: Pcal_1526Help
Entry
Pcal_1526         CDS       T00483                                 

Definition
precorrin-8X methylmutase (EC:5.4.1.2)
Orthology
K06042  
precorrin-8X/cobalt-precorrin-8 methylmutase [EC:5.4.99.61 5.4.99.60]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pcl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1425496..1426467)
Genome map
AA seq 323 aa AA seqDB search
MEVIVVNHGSRRSAFNELMERWAAEASKRLGVRAVVGYNEYAEPNWRQLIREAEGDVIIA
LAFLGEGNHVAKDILRELGVDFEQWATSPTYGKRVYVTRPLGDSPLVLSAFLSRIVRAIE
AGEGARQSPDVVWDPEEVEESSMRYVAERLGLDLSNWRDRLIARAVYASGNLELAKNVWI
SPDLLKAAEEAVRAEVPAVADVRMVAAGLKYRRVYVAVDAPAQAIGVTRAAQGVRHWLRE
LKHGILAVGNAPTALKAGLDAWRSGEAELAFAVASPVGFTNAERVKEELVESGIPAAVVR
GTYGGSGIAVALFNELVKLAHGR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcatagttgtcaaccacggctcccggaggtcggcgtttaacgagctaatggag
aggtgggccgccgaggcgtcaaagcgccttggagttagggccgtggtggggtacaacgaa
tacgccgagcccaactggcggcaactaataagagaagcggagggagacgtgataattgcg
ctggccttcctcggcgaggggaaccacgtggccaaggacatcctccgcgaattaggcgtg
gactttgagcagtgggccacctctcccacgtatgggaagagggtctatgtgacaaggccg
ctgggcgactcgccgctggtgttgtcagcctttctctcacgcatagtaagggccattgag
gcaggcgagggcgcgcggcagagcccagacgtcgtgtgggatccagaggaggtggaggag
tcgtctatgaggtacgtggctgaaaggctaggcctcgacttgtccaactggagagaccgc
ctcatagccagggcggtttatgcaagcggcaacctagagctggcgaagaacgtgtggatt
tcccccgacttgctcaaggccgccgaggaggcagtgcgtgccgaggtgccagctgtcgct
gacgtgagaatggtggccgctgggctcaagtaccgaagggtgtacgtggcagtggatgcg
cccgctcaagcaataggcgtgacgagggcggcgcagggcgtgcgccactggctcagagag
cttaagcacgggatcttagcagtgggcaatgcccccacggcgcttaaggcaggcttagac
gcgtggaggagcggcgaggctgagttggcctttgcggtggcgtcccccgtgggcttcacc
aatgccgagagagtcaaggaggagctcgtggagtctggcatccccgccgcagtggtcagg
gggacatacggcggatctggaatcgccgtggcgcttttcaacgagctggtcaagctggcc
catgggcggtaa

DBGET integrated database retrieval system