KEGG   Pyrobaculum calidifontis: Pcal_1526Help
Entry
Pcal_1526         CDS       T00483                                 

Definition
precorrin-8X methylmutase (EC:5.4.1.2)
Orthology
K06042  
precorrin-8X/cobalt-precorrin-8 methylmutase [EC:5.4.99.61 5.4.99.60]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pcal_1526
Enzymes [BR:pcl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.60  cobalt-precorrin-8 methylmutase
     Pcal_1526
    5.4.99.61  precorrin-8X methylmutase
     Pcal_1526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1425496..1426467)
Genome map
AA seq 323 aa AA seqDB search
MEVIVVNHGSRRSAFNELMERWAAEASKRLGVRAVVGYNEYAEPNWRQLIREAEGDVIIA
LAFLGEGNHVAKDILRELGVDFEQWATSPTYGKRVYVTRPLGDSPLVLSAFLSRIVRAIE
AGEGARQSPDVVWDPEEVEESSMRYVAERLGLDLSNWRDRLIARAVYASGNLELAKNVWI
SPDLLKAAEEAVRAEVPAVADVRMVAAGLKYRRVYVAVDAPAQAIGVTRAAQGVRHWLRE
LKHGILAVGNAPTALKAGLDAWRSGEAELAFAVASPVGFTNAERVKEELVESGIPAAVVR
GTYGGSGIAVALFNELVKLAHGR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcatagttgtcaaccacggctcccggaggtcggcgtttaacgagctaatggag
aggtgggccgccgaggcgtcaaagcgccttggagttagggccgtggtggggtacaacgaa
tacgccgagcccaactggcggcaactaataagagaagcggagggagacgtgataattgcg
ctggccttcctcggcgaggggaaccacgtggccaaggacatcctccgcgaattaggcgtg
gactttgagcagtgggccacctctcccacgtatgggaagagggtctatgtgacaaggccg
ctgggcgactcgccgctggtgttgtcagcctttctctcacgcatagtaagggccattgag
gcaggcgagggcgcgcggcagagcccagacgtcgtgtgggatccagaggaggtggaggag
tcgtctatgaggtacgtggctgaaaggctaggcctcgacttgtccaactggagagaccgc
ctcatagccagggcggtttatgcaagcggcaacctagagctggcgaagaacgtgtggatt
tcccccgacttgctcaaggccgccgaggaggcagtgcgtgccgaggtgccagctgtcgct
gacgtgagaatggtggccgctgggctcaagtaccgaagggtgtacgtggcagtggatgcg
cccgctcaagcaataggcgtgacgagggcggcgcagggcgtgcgccactggctcagagag
cttaagcacgggatcttagcagtgggcaatgcccccacggcgcttaaggcaggcttagac
gcgtggaggagcggcgaggctgagttggcctttgcggtggcgtcccccgtgggcttcacc
aatgccgagagagtcaaggaggagctcgtggagtctggcatccccgccgcagtggtcagg
gggacatacggcggatctggaatcgccgtggcgcttttcaacgagctggtcaagctggcc
catgggcggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system