KEGG   Pyrobaculum calidifontis: Pcal_1537Help
Entry
Pcal_1537         CDS       T00483                                 

Definition
aspartate-ammonia ligase (EC:6.3.1.1)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pcl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1433937..1434761)
Genome map
AA seq 274 aa AA seqDB search
MIVDLLSKYAECDGVLLSGGIDSTLVAYAARRIGHVPVGITVSLVSCQGDLPFALYAAAR
LSTPLSIVQVRLVEALDYVERAMEVLKNFNAMELVNCAVQYAGLERARDLGLRRVCTGDG
GDELFLGYSFYRKYPLHALEEKRREIVAKWRFCSRQIAQALGLEAVLPFTENEVVKFALA
LPAAEVLDKKPLREALKGVAPLIAARRKTPLEEGSCFNRLYEEMEKRAGSPYAYLCRLFE
AKGFQYLRSAEGCPRCGYAQFDGYCSMCGYYEER
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtagacctcttgtctaagtatgcggagtgtgacggcgtcctcctctccggggga
attgatagcactttggtggcctacgccgcgaggcggataggacatgtgcccgtcggcata
acagtgtcgctggtcagttgccagggggatttgccatttgccttatacgccgcggcccgc
ctctccacccccctctccattgtgcaagtgagacttgtagaggcgctcgactacgtggag
agggccatggaggtgttgaagaacttcaacgccatggagctcgtaaactgcgcagtgcag
tatgctgggcttgagagggcgagggacttggggcttaggagggtgtgtacaggcgacggg
ggagacgagcttttcctcggctactccttctaccgcaaatatcccctccacgcgcttgag
gaaaaacgccgcgagatagtggcaaagtggaggttctgtagccgccagatagcccaggcc
ttgggcctagaggcggtgctccccttcacagagaacgaggtggtgaaatttgcgctcgct
ctgccagccgccgaggtcttagacaaaaagccgcttagagaggccctaaagggcgtggcg
ccgctaatcgccgcgaggaggaagaccccgctggaggagggtagttgcttcaaccgcctg
tacgaggagatggagaagagggctgggagcccctacgcctacctctgccgcctctttgaa
gcaaagggcttccaatacctgcggagcgccgaggggtgccctagatgcggctacgctcaa
ttcgacggctactgctccatgtgcggctactatgaagagcggtaa

DBGET integrated database retrieval system