KEGG   Pyrobaculum calidifontis: Pcal_1581Help
Entry
Pcal_1581         CDS       T00483                                 

Definition
Alcohol dehydrogenase GroES domain protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pcal_1581
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_1581
  Lipid metabolism
   00071 Fatty acid degradation
    Pcal_1581
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pcal_1581
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pcal_1581
   00626 Naphthalene degradation
    Pcal_1581
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pcal_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1470715..1471752
Genome map
AA seq 345 aa AA seqDB search
MTRDCCEKSGVFTAACPPHLIFLSRVFDVLAAVLEGPRRLFVREVAVPRVEGYALVRSEL
VGICGTDKAFYVGTYPLFKRPLVPGHEVVGIVVEGPPHLVGRRVVSEINFPDWSCDYCRS
GLYTHCPYKRTLGIDFDGGMAEFFAAPPTALHVFDGPPELGIFVEPLAAVLNAFAIRPIR
PGDKVAVIGTGNVAQLAAQAARALGASRVDGVVRRGSRKAATLAKFVDAVVEEPAESAYD
VVFEASGDPSALELAVRLAKPRGVVHLKSTPGLPATFNATYFVVKEVAVVGSRCGTFREF
REAIRLLLSGAVKPTLDAVFPLAEAREAFEYAVEKSPTKVAVRVS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgactgttgcgaaaagtctggcgtatttacggcggcctgcccgccacatctt
atatttttatcccgtgtttttgacgtgcttgcggctgtcttggaggggcctaggaggctc
tttgtgcgagaggtggcggtgcccagggtggaggggtatgcccttgtgaggagcgagctc
gtggggatatgtggaactgacaaggccttctacgttggcacataccctctctttaagcgc
cccctcgtgcctggccacgaggttgtgggaatagtggtggaggggccgccccacttggtg
gggaggcgggtggtgagcgagataaacttcccggactggtcttgcgactactgtaggtcg
gggctgtatacccactgtccctacaagcggaccttgggcatagacttcgacgggggcatg
gcggagttcttcgccgccccgcccacggcgttgcacgtcttcgatgggccgccggagttg
ggcatcttcgtggagcccctcgccgcggtgttaaacgcctttgccattaggccgattcgc
cctggggacaaggtggctgtgattggcacgggtaacgtggcccagctggcggcgcaggcg
gcgagggcactcggcgcgtcgcgggtagacggcgtggttaggcgggggagcaggaaggcc
gcaaccctcgccaagttcgtagacgcagtggtggaggagccggccgaatccgcctacgac
gtggtcttcgaggcctcgggtgacccctcggcgctggagctggcggtgcgcttggccaag
cccaggggggtcgtccacctgaagtccacgccgggcctcccagcgactttcaacgccacg
tacttcgtggtgaaggaggtggctgtggtggggtcgaggtgcggcacctttagggagttt
agggaggcgatacgccttctgctaagcggcgcggttaagcccactctagacgccgtcttc
cctctcgcagaggcgcgggaggcctttgaatacgccgtggaaaagtcgccgactaaggtg
gcagtccgcgtctcctag

DBGET integrated database retrieval system