KEGG   Pyrobaculum calidifontis: Pcal_1581Help
Entry
Pcal_1581         CDS       T00483                                 

Definition
Alcohol dehydrogenase GroES domain protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:pcl01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcl00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pcl00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pcl00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:pcl00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:pcl00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1470715..1471752
Genome map
AA seq 345 aa AA seqDB search
MTRDCCEKSGVFTAACPPHLIFLSRVFDVLAAVLEGPRRLFVREVAVPRVEGYALVRSEL
VGICGTDKAFYVGTYPLFKRPLVPGHEVVGIVVEGPPHLVGRRVVSEINFPDWSCDYCRS
GLYTHCPYKRTLGIDFDGGMAEFFAAPPTALHVFDGPPELGIFVEPLAAVLNAFAIRPIR
PGDKVAVIGTGNVAQLAAQAARALGASRVDGVVRRGSRKAATLAKFVDAVVEEPAESAYD
VVFEASGDPSALELAVRLAKPRGVVHLKSTPGLPATFNATYFVVKEVAVVGSRCGTFREF
REAIRLLLSGAVKPTLDAVFPLAEAREAFEYAVEKSPTKVAVRVS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgactgttgcgaaaagtctggcgtatttacggcggcctgcccgccacatctt
atatttttatcccgtgtttttgacgtgcttgcggctgtcttggaggggcctaggaggctc
tttgtgcgagaggtggcggtgcccagggtggaggggtatgcccttgtgaggagcgagctc
gtggggatatgtggaactgacaaggccttctacgttggcacataccctctctttaagcgc
cccctcgtgcctggccacgaggttgtgggaatagtggtggaggggccgccccacttggtg
gggaggcgggtggtgagcgagataaacttcccggactggtcttgcgactactgtaggtcg
gggctgtatacccactgtccctacaagcggaccttgggcatagacttcgacgggggcatg
gcggagttcttcgccgccccgcccacggcgttgcacgtcttcgatgggccgccggagttg
ggcatcttcgtggagcccctcgccgcggtgttaaacgcctttgccattaggccgattcgc
cctggggacaaggtggctgtgattggcacgggtaacgtggcccagctggcggcgcaggcg
gcgagggcactcggcgcgtcgcgggtagacggcgtggttaggcgggggagcaggaaggcc
gcaaccctcgccaagttcgtagacgcagtggtggaggagccggccgaatccgcctacgac
gtggtcttcgaggcctcgggtgacccctcggcgctggagctggcggtgcgcttggccaag
cccaggggggtcgtccacctgaagtccacgccgggcctcccagcgactttcaacgccacg
tacttcgtggtgaaggaggtggctgtggtggggtcgaggtgcggcacctttagggagttt
agggaggcgatacgccttctgctaagcggcgcggttaagcccactctagacgccgtcttc
cctctcgcagaggcgcgggaggcctttgaatacgccgtggaaaagtcgccgactaaggtg
gcagtccgcgtctcctag

DBGET integrated database retrieval system